DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdi and M04D5.1

DIOPT Version :9

Sequence 1:NP_001287070.1 Gene:Pdi / 39651 FlyBaseID:FBgn0286818 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_001251622.1 Gene:M04D5.1 / 13182108 WormBaseID:WBGene00014807 Length:332 Species:Caenorhabditis elegans


Alignment Length:342 Identity:82/342 - (23%)
Similarity:142/342 - (41%) Gaps:52/342 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 IAIIGFFKDLESEEAKTFTKVANALDSFVFGVSSNADVIAKYEAKDNGVVLFKPFDDKKSVFEGE 219
            :..:.:|:..:...|:.|..:....:...:|::.:::|.|.....:.|.|:.     .||....|
 Worm     7 VVTLAYFEKTDFYLARIFELMYERDNDIFYGITDSSEVAASVNLDEYGFVII-----TKSKEGRE 66

  Fly   220 LNEENLKKFAQVQS----------LPLIVDFNHESASKIFGGSIKS-HLLFFVSREGGH---IEK 270
            :...:.:..||..|          |||::.........:....... |:|:....:..:   |.|
 Worm    67 MRYFSEQDLAQDYSAFIRWYHEFKLPLVITSRQNMKDAVETRQFNMVHVLYIKKSDTDYNSTISK 131

  Fly   271 YVDPLKEIAKKYRDDILFVTISSDE-EDHT----RIFEFFGMNKEEVPTIRLIKLEEDMAKYKPE 330
            :.|..:....:::  |||.....|| .|:|    ||......:....|:..:         ||..
 Worm   132 FTDTARRFHGRFK--ILFFIRHLDESRDNTYIPKRIRFLINYSPTTTPSSVI---------YKER 185

  Fly   331 SDD------LSAETIEAFLKKFLDGKLKQHLLSQELPEDWDKNPVKVLVSSNFESVALDKSKSVL 389
            :..      :...:.|.|....|.|.:.::..||:||:|||..||||||.|||..|..:|:.:||
 Worm   186 NSHYVMFKLIGNSSFEEFTTSVLRGNVPRYYQSQDLPKDWDAKPVKVLVQSNFHEVVFNKTNNVL 250

  Fly   390 VEFYAPWCGHCKQLAPIYDQLAEKYKDNEDIVIAKMDSTANELESIKISSFPTIKYFRKEDNKVI 454
            |.|...:...    .|..|:|||::|..  :|||:||:..||:..::|...||.:.:.......:
 Worm   251 VFFIETYYFD----EPALDELAEQFKST--VVIARMDTDKNEIPGMEIKENPTWRLWPAVTKIPV 309

  Fly   455 DFN-----LDRTLDDFV 466
            ||.     .|..|.||:
 Worm   310 DFKDAYGWNDEKLRDFL 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdiNP_001287070.1 ER_PDI_fam 27..474 CDD:273457 82/342 (24%)
pdi_dom 33..133 CDD:273454
PDI_b_family 137..231 CDD:239279 12/75 (16%)
PDI_b'_family 244..347 CDD:239280 19/117 (16%)
PDI_a_PDI_a'_C 368..469 CDD:239293 37/104 (36%)
M04D5.1NP_001251622.1 ER_PDI_fam <2..329 CDD:273457 82/342 (24%)
Thioredoxin_like 229..311 CDD:294274 31/87 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0190
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D462118at2759
OrthoFinder 1 1.000 - - FOG0000292
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18929
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.