DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdi and ERP27

DIOPT Version :9

Sequence 1:NP_001287070.1 Gene:Pdi / 39651 FlyBaseID:FBgn0286818 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_689534.1 Gene:ERP27 / 121506 HGNCID:26495 Length:273 Species:Homo sapiens


Alignment Length:239 Identity:63/239 - (26%)
Similarity:124/239 - (51%) Gaps:10/239 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 AADIIAWVTKKT-GPPAKD----LTSVADAEQFLKDNEIAIIGFFKDLESEEAKTFTKVANALDS 181
            ||::.|.|.|.: ||.|..    ||.|..|.:|:...|:|:||||:|||.........:......
Human    20 AAEVAAEVEKSSDGPGAAQEPTWLTDVPAAMEFIAATEVAVIGFFQDLEIPAVPILHSMVQKFPG 84

  Fly   182 FVFGVSSNADVIAKYEAKDNGVVLFKPFDDKKSVFEGE----LNEENLKKFAQVQSLPLIVDFNH 242
            ..||:|::::|:..|....|.:.||:..|:::...|.|    ::...|.:|.::.||.::.::|.
Human    85 VSFGISTDSEVLTHYNITGNTICLFRLVDNEQLNLEDEDIESIDATKLSRFIEINSLHMVTEYNP 149

  Fly   243 ESASKIFGGSIKSHLLFFVSREGGHIEKYVDPLKEIAKKYRDDILFVTISSDEEDHTRIFEFFGM 307
            .:...:|...|:.|||..:::.....|:.:...::.||.::..|||:.:.|..:::.::..||.:
Human   150 VTVIGLFNSVIQIHLLLIMNKASPEYEENMHRYQKAAKLFQGKILFILVDSGMKENGKVISFFKL 214

  Fly   308 NKEEVPTIRLIKLEEDMAKYKPESDDLSAETIEAFLKKFLDGKL 351
            .:.::|.:.:.:..:|.....|.: ::|.|.::.|...||.|||
Human   215 KESQLPALAIYQTLDDEWDTLPTA-EVSVEHVQNFCDGFLSGKL 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdiNP_001287070.1 ER_PDI_fam 27..474 CDD:273457 63/239 (26%)
pdi_dom 33..133 CDD:273454 5/10 (50%)
PDI_b_family 137..231 CDD:239279 28/101 (28%)
PDI_b'_family 244..347 CDD:239280 20/102 (20%)
PDI_a_PDI_a'_C 368..469 CDD:239293
ERP27NP_689534.1 Thioredoxin_6 64..250 CDD:372755 40/186 (22%)
PDIA3-binding site. /evidence=ECO:0000269|PubMed:16940051 230..233 1/2 (50%)
Prevents secretion from ER. /evidence=ECO:0000305|PubMed:16940051 270..273
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156378
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D462118at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18929
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.