DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdi and Txndc5

DIOPT Version :9

Sequence 1:NP_001287070.1 Gene:Pdi / 39651 FlyBaseID:FBgn0286818 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_663342.3 Gene:Txndc5 / 105245 MGIID:2145316 Length:417 Species:Mus musculus


Alignment Length:506 Identity:120/506 - (23%)
Similarity:190/506 - (37%) Gaps:154/506 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LICALFLAASYVAASAEAEVKVEEGV-------LVATVDNFKQLI-ADNEFVLVEFYAPWCGHCK 60
            |...|.|..:...|.|: ||:.:.||       .:.|.|.|...| :...||:  |:|||||||:
Mouse    18 LATLLLLLGARKGARAQ-EVEADSGVEQDPHAKHLYTADMFTHGIQSAAHFVM--FFAPWCGHCQ 79

  Fly    61 ALAPEYAKAAQQLAEK-----ESPIKLAKVDATVEGELAEQYAVRGYPTLKFFRSG-SPVEYSGG 119
            .|.|.:    ..|.:|     ::.:.:||||.|.:.::.....||||||||||:.| ..|:|.|.
Mouse    80 RLQPTW----NDLGDKYNSMEDAKVYVAKVDCTADSDVCSAQGVRGYPTLKFFKPGQEAVKYQGP 140

  Fly   120 RQAADIIAWVTK------KTGPPAKDLTSVADAEQFLKDNEIAIIGFFKDLESEEAKTFTK---- 174
            |....:..|:.:      .|..|..:.....:.:|.|  .|::...|  :|...:...|.|    
Mouse   141 RDFETLENWMLQTLNEEPATPEPEAEPPRAPELKQGL--YELSANNF--ELHVSQGNHFIKFFAP 201

  Fly   175 -------VANALDSFVFGVSSNADV-IAKYEAKDNGVVLFKPFDDKKSVFEGELNEENLKKFAQV 231
                   :|...:....|:..:..| |.|.:...:..|..:                     .||
Mouse   202 WCGHCKALAPTWEQLALGLEHSETVKIGKVDCTQHYAVCSE---------------------HQV 245

  Fly   232 QSLPLIVDFNHESASKIFGGSIKSHLLFFVSREGGHIEKYVDPLKEIAKKYRDDILFVTISSDEE 296
            :..|.                    ||:|  |:|..:::|                         
Mouse   246 RGYPT--------------------LLWF--RDGKKVDQY------------------------- 263

  Fly   297 DHTRIFEFFGMNKEEVPTIRLIKLEEDMAKYKPESDDLSAETIEAFLKKFLDGKLKQHLLSQELP 361
                      ..|.::.::|      |..:.:.:..:.:.||:|                ..|.|
Mouse   264 ----------KGKRDLESLR------DYVQSQLQGSEAAPETVE----------------PSEAP 296

  Fly   362 -----EDWDKNPVKVLVSSNFESVALDKSKSVLVEFYAPWCGHCKQLAPIYDQLAEK-YKDNEDI 420
                 ...||..|..|...:||...  ......|:||||||||||.|||.:::|::| :....|:
Mouse   297 VMAAEPTGDKGTVLALTEKSFEDTI--AQGITFVKFYAPWCGHCKNLAPTWEELSKKEFPGLSDV 359

  Fly   421 VIAKMDSTA--NELESIKISSFPTIKYFRKEDNKVIDFNLDRTLDDFVKFL 469
            .||::|.||  |......:..:||:..||..: ||.:.|..|.||....|:
Mouse   360 TIAEVDCTAERNVCSKYSVRGYPTLLLFRGGE-KVGEHNGGRDLDSLHSFV 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdiNP_001287070.1 ER_PDI_fam 27..474 CDD:273457 113/483 (23%)
pdi_dom 33..133 CDD:273454 39/112 (35%)
PDI_b_family 137..231 CDD:239279 13/105 (12%)
PDI_b'_family 244..347 CDD:239280 12/102 (12%)
PDI_a_PDI_a'_C 368..469 CDD:239293 37/103 (36%)
Txndc5NP_663342.3 PDI_a_ERp46 47..150 CDD:239303 38/108 (35%)
ER_PDI_fam 52..417 CDD:273457 111/471 (24%)
PDI_a_ERp46 176..276 CDD:239303 24/187 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 281..302 5/36 (14%)
PDI_a_ERp46 308..409 CDD:239303 37/103 (36%)
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 414..417
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.