DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdi and TXNDC9

DIOPT Version :9

Sequence 1:NP_001287070.1 Gene:Pdi / 39651 FlyBaseID:FBgn0286818 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_005774.2 Gene:TXNDC9 / 10190 HGNCID:24110 Length:226 Species:Homo sapiens


Alignment Length:84 Identity:22/84 - (26%)
Similarity:36/84 - (42%) Gaps:4/84 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 NFKQLIADNEFVLVEFYAPWCGHCKALAPEYAKAAQQLAEKESPIKLAKVDATVEGELAEQYAVR 100
            :|.|.:.::|.|:..||......||.|....|    .|::|....|..|::......|.|:..::
Human    81 DFFQEVKESENVVCHFYRDSTFRCKILDRHLA----ILSKKHLETKFLKLNVEKAPFLCERLHIK 141

  Fly   101 GYPTLKFFRSGSPVEYSGG 119
            ..|||...:.|...:|..|
Human   142 VIPTLALLKDGKTQDYVVG 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdiNP_001287070.1 ER_PDI_fam 27..474 CDD:273457 22/84 (26%)
pdi_dom 33..133 CDD:273454 22/84 (26%)
PDI_b_family 137..231 CDD:239279
PDI_b'_family 244..347 CDD:239280
PDI_a_PDI_a'_C 368..469 CDD:239293
TXNDC9NP_005774.2 Phd_like_TxnDC9 68..180 CDD:239287 22/84 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.