DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdi and erp27

DIOPT Version :9

Sequence 1:NP_001287070.1 Gene:Pdi / 39651 FlyBaseID:FBgn0286818 Length:496 Species:Drosophila melanogaster
Sequence 2:XP_002935653.1 Gene:erp27 / 100493546 XenbaseID:XB-GENE-6464220 Length:271 Species:Xenopus tropicalis


Alignment Length:288 Identity:68/288 - (23%)
Similarity:135/288 - (46%) Gaps:26/288 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 VEGELAEQYAVRGYPTLKFFRSGSPVEYSGGRQAADIIAWVTKKTGP--PAKDLTSVADAEQFLK 151
            :||.:.       :||:.|......:..|.|.:.|:    .||...|  .||.|..|...:.|::
 Frog     1 MEGSMT-------WPTVSFLLLVILISTSSGEEVAN----STKIEEPVSSAKILADVPSTKAFIE 54

  Fly   152 DNEIAIIGFFKDLESEEAKTFTKVANALDSFVFGVSSNADVIAKYEAKDNGVVLFKPFDDKKS-- 214
            .:|||:|||.:|.|:.|.|.|..:.:....:.:|:|::.:|:..::.:.|.|.||:..|:|:.  
 Frog    55 SSEIAVIGFIQDPEAPEVKEFNTLISKHPEWDYGLSTSKEVLKHFKIESNTVALFRQVDNKRDDL 119

  Fly   215 VFEGE--LNEENLKKFAQVQSLPLIVDFNHESASKIFGGSIKSHLLFFVSREGGHIEKYVDPLKE 277
            :.:..  :|.|.|.:|..:..|..:.|:|..:|..:....::.|:|.|:.:...:.|:.:...:|
 Frog   120 ILKDHPGINTEKLFRFLTINELRTVTDYNAVTAVGLLNSKVQIHMLLFIDKGAQNQEEILKEFRE 184

  Fly   278 IAKKYRDDILFVTISSDEEDHTRIFEFFGMNKEEVPTIRLIKLEEDMAKYKPESDDLSAETIEAF 342
            .|.:.:..:|||.:......:.::..:|...:.::|.:.:...|.:..|.. ::..:|:..:..|
 Frog   185 AAVELKGKVLFVKVDVSIRSNEKVMSYFQFKRSDLPRVAIFNSENETKKIM-DAGPISSTRLRDF 248

  Fly   343 LKKFLDGKLKQHLLSQELPEDWDKNPVK 370
            ...||.||...        |:.||..||
 Frog   249 CYGFLSGKTDD--------EESDKKEVK 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdiNP_001287070.1 ER_PDI_fam 27..474 CDD:273457 68/288 (24%)
pdi_dom 33..133 CDD:273454 10/43 (23%)
PDI_b_family 137..231 CDD:239279 29/97 (30%)
PDI_b'_family 244..347 CDD:239280 16/102 (16%)
PDI_a_PDI_a'_C 368..469 CDD:239293 2/3 (67%)
erp27XP_002935653.1 Thioredoxin_6 65..249 CDD:372755 36/184 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D462118at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.