DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdi and erp27

DIOPT Version :9

Sequence 1:NP_001287070.1 Gene:Pdi / 39651 FlyBaseID:FBgn0286818 Length:496 Species:Drosophila melanogaster
Sequence 2:XP_017209875.1 Gene:erp27 / 100004902 -ID:- Length:252 Species:Danio rerio


Alignment Length:240 Identity:55/240 - (22%)
Similarity:116/240 - (48%) Gaps:31/240 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 LTSVADAEQFLKDNEIAIIGFFKDLESEEAKTFTKVANALDSFVFGVSSNADVIAKYEAKDNGVV 204
            |...|.|:.|:...::|:||||:|..:.....|......:......:.|..:|.|||....:.:.
Zfish    26 LADAAAAQAFIDSADVAVIGFFQDESARGYSEFLDAVKQMQELPVALCSEKEVWAKYGISSDTIS 90

  Fly   205 LFKPFDDKKSVFEGELNEENLK-------------KFAQVQSLPLIVDFNHESASKIFGGSIKSH 256
            :|:         :.:|::|:||             :|..:.::..:.::|..||..||..|:|:|
Zfish    91 VFR---------KADLHQEHLKLSEAKKVDSAGLLRFLIINNISYVTEYNQASAVGIFQSSVKTH 146

  Fly   257 LLFFVSREGGHIEKYVDP----LKEIAKKYRDDILFVTISSDEEDHTRIFEFFGMNKEEVPTIRL 317
            :|...:  ||....  ||    .:::|.||...:||:.::..::.::|:.|:|.:...::|.:.|
Zfish   147 VLLVCA--GGRSAS--DPQQKLFRDLAVKYAGKMLFILVNGADKSNSRVLEYFSLKSADLPRVGL 207

  Fly   318 IKLEEDMAKYKPESDDLSAETIEAFLKKFLDGKLKQHLLSQELPE 362
            ..:..|. |:...:.:::.|.::.|...||||:|::...:::..|
Zfish   208 YDVTLDQ-KWLMAAGEITTERVQNFCDSFLDGELQKQRDAEDKTE 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PdiNP_001287070.1 ER_PDI_fam 27..474 CDD:273457 55/240 (23%)
pdi_dom 33..133 CDD:273454
PDI_b_family 137..231 CDD:239279 22/103 (21%)
PDI_b'_family 244..347 CDD:239280 26/106 (25%)
PDI_a_PDI_a'_C 368..469 CDD:239293
erp27XP_017209875.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D462118at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.