DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sstn and EZR

DIOPT Version :9

Sequence 1:NP_648745.1 Gene:sstn / 39643 FlyBaseID:FBgn0036476 Length:635 Species:Drosophila melanogaster
Sequence 2:NP_001104547.1 Gene:EZR / 7430 HGNCID:12691 Length:586 Species:Homo sapiens


Alignment Length:292 Identity:55/292 - (18%)
Similarity:108/292 - (36%) Gaps:80/292 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 QIQKQETAIINGNYE---------HMTVNEFFVQLAQQYKHEQQLQALARENSSILRRKQSTTSR 138
            :|.|:...:..||:|         .:.|.:...| |::.||::||:   |:.....::::.|..|
Human   275 RINKRILQLCMGNHELYMRRRKPDTIEVQQMKAQ-AREEKHQKQLE---RQQLETEKKRRETVER 335

  Fly   139 ESRDSQMTINNNNRQSETLSNRSSEYDNYQPSSSAGAGDMLVIGV--------AQQQAQQQPPLV 195
            |.  .||.     |:.|.|..|..:|:.....:.....:.:...:        ||::|::.....
Human   336 EK--EQMM-----REKEELMLRLQDYEEKTKKAERELSEQIQRALQLEEERKRAQEEAERLEADR 393

  Fly   196 KSALKKRPTPTPSQMQYMRQQHQQQAHL-------AMNMNYQRSQPDVISMY-----SANSSNVA 248
            .:||:.:.......:..::.|.|..|.|       |:....:|.:.|.:..:     .|....|.
Human   394 MAALRAKEELERQAVDQIKSQEQLAAELAEYTAKIALLEEARRRKEDEVEEWQHRAKEAQDDLVK 458

  Fly   249 TLRQ--------PPQVAPQQQPIIVQCDKYYLSPTHQSYNEG----GF--------IKSSQNIKK 293
            |..:        ||...|..:|:     .|::..:.|  :||    |:        |:..:|.:|
Human   459 TKEELHLVMTAPPPPPPPVYEPV-----SYHVQESLQ--DEGAEPTGYSAELSSEGIRDDRNEEK 516

  Fly   294 YVSPMASPSNISYEQQQQRNPLHHQRQLDAIS 325
            .::.......:             ||||..:|
Human   517 RITEAEKNERV-------------QRQLLTLS 535

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sstnNP_648745.1 None
EZRNP_001104547.1 B41 7..206 CDD:214604
[IL]-x-C-x-x-[DE] motif. /evidence=ECO:0000305|PubMed:25417112 115..120
FERM_C_ERM 200..296 CDD:270015 5/20 (25%)
Interaction with SCYL3. /evidence=ECO:0000269|PubMed:12651155 244..586 55/292 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 306..341 11/40 (28%)
ERM 338..586 CDD:395622 39/223 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 485..564 12/66 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3529
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.