DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sstn and nf2a

DIOPT Version :9

Sequence 1:NP_648745.1 Gene:sstn / 39643 FlyBaseID:FBgn0036476 Length:635 Species:Drosophila melanogaster
Sequence 2:NP_001122179.1 Gene:nf2a / 561184 ZFINID:ZDB-GENE-080722-7 Length:593 Species:Danio rerio


Alignment Length:297 Identity:57/297 - (19%)
Similarity:112/297 - (37%) Gaps:68/297 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 SEKSWLLQQIQKQETAIINGNYEHMTVNEFFVQLAQQYKHE-------------QQLQALARENS 126
            |:|.:.::.:.|: ..:...|...:.||:..:||... .|:             ||::..|||..
Zfish   266 SDKEFAIKPVDKR-ADVFKFNSSKLRVNKLILQLCIG-NHDLFMRRRRVDSLEVQQMKTQAREEK 328

  Fly   127 SILRRKQSTTSRESRDSQMTINNNNRQSETLSNR------SSEYDNYQPSSSAGAGDMLV--IGV 183
            :   |||....|..|:.|:. .:..|..:.|..|      .:...|.....|....|:|.  ..:
Zfish   329 A---RKQMERQRLEREKQLR-EDAERARDELQRRLIQLQDEAHLANEALLRSEETADLLAEKAQI 389

  Fly   184 AQQQAQQQPPLVKSALKKRPTPTPSQMQYMRQ---QHQQQAHLAMNMNYQRSQPDVISMYSANSS 245
            |:::|:        .|.::......:||.::.   :.:::..|   |..:..:.::|::..|..|
Zfish   390 AEEEAK--------LLAQKAAEAEQEMQRIKVTAIRSEEEKRL---MEQKMLEAEMIALKMAEES 443

  Fly   246 -----NVATLRQPPQVAPQQQ-----PIIVQCDKYYLSPTHQSYN----EG-GFIKSSQNIK--- 292
                 ....|:|..|.|.:.:     .::....|...||...|.|    :| .|..|.:|:.   
Zfish   444 ERRAKEADQLKQDLQEARESERRAKNKLLEITSKTEYSPVPLSANSLPADGPNFNFSMENLSFDF 508

  Fly   293 -----KYVSPMASPSNISYEQQQQRNPLHHQRQLDAI 324
                 |.:|.......:.|.::.:    |.|.||:.:
Zfish   509 KDTDMKRLSMEIEKEKVEYMEKSK----HLQEQLNEL 541

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sstnNP_648745.1 None
nf2aNP_001122179.1 B41 23..221 CDD:214604
FERM_N 25..85 CDD:286467
FERM_M 106..221 CDD:278785
FERM_C_ERM 215..311 CDD:270015 9/46 (20%)
SKIP_SNW <323..354 CDD:280827 10/34 (29%)
GBP_C <334..462 CDD:303769 24/139 (17%)
ERM 346..593 CDD:279153 37/211 (18%)
coiled coil 453..462 CDD:293879 4/8 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3529
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.