DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sstn and NF2

DIOPT Version :9

Sequence 1:NP_648745.1 Gene:sstn / 39643 FlyBaseID:FBgn0036476 Length:635 Species:Drosophila melanogaster
Sequence 2:NP_000259.1 Gene:NF2 / 4771 HGNCID:7773 Length:595 Species:Homo sapiens


Alignment Length:337 Identity:67/337 - (19%)
Similarity:128/337 - (37%) Gaps:77/337 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 SEKSWLLQQIQKQETAIINGNYEHMTVNEFFVQLA--------QQYKHE----QQLQALARENSS 127
            |:|.:.::.:.| :..:...|...:.||:..:||.        ::.|.:    ||::|.|||..:
Human   267 SDKEFTIKPLDK-KIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRKADSLEVQQMKAQAREEKA 330

  Fly   128 ILRRKQSTTSRESRDSQMTINNNNRQSE------------TLSN----RSSE-YDNYQPSSSAGA 175
               |||....|.:|:.||.......:.|            |::|    ||.| .|.....:....
Human   331 ---RKQMERQRLAREKQMREEAERTRDELERRLLQMKEEATMANEALMRSEETADLLAEKAQITE 392

  Fly   176 GDMLVIGVAQQQAQQQPPLVKSALKKRPTPTPSQMQYMRQQHQQQAHLAMNM----NYQRSQPDV 236
            .:..::.....:|:|:...:|:...:    |..:.:.|.|:..:...||:.|    ..:..:.|.
Human   393 EEAKLLAQKAAEAEQEMQRIKATAIR----TEEEKRLMEQKVLEAEVLALKMAEESERRAKEADQ 453

  Fly   237 I--SMYSANSS---------NVATLRQPPQVAPQQQPIIVQCDKYYLSPTHQSYNEGG----FIK 286
            :  .:..|..:         .:||....|.:.|...|         |.|...|:|..|    |..
Human   454 LKQDLQEAREAERRAKQKLLEIATKPTYPPMNPIPAP---------LPPDIPSFNLIGDSLSFDF 509

  Fly   287 SSQNIKKYVSPMASPSNISYEQ-----QQQRNPLHHQRQLDAISLAPSYVSVDMEAAQHQQQYRW 346
            ...::|: :|.......:.|.:     |:|.|.|  :.:::|:.|.....::|:  ..::...|.
Human   510 KDTDMKR-LSMEIEKEKVEYMEKSKHLQEQLNEL--KTEIEALKLKERETALDI--LHNENSDRG 569

  Fly   347 RSQSH--IAPLT 356
            .|..|  |..||
Human   570 GSSKHNTIKKLT 581

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sstnNP_648745.1 None
NF2NP_000259.1 B41 23..222 CDD:214604
FERM_C_ERM 216..312 CDD:270015 8/45 (18%)
PLN03086 307..>367 CDD:178635 15/62 (24%)
ERM 347..595 CDD:366293 45/253 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3529
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.