DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sstn and MSN

DIOPT Version :9

Sequence 1:NP_648745.1 Gene:sstn / 39643 FlyBaseID:FBgn0036476 Length:635 Species:Drosophila melanogaster
Sequence 2:XP_011529261.1 Gene:MSN / 4478 HGNCID:7373 Length:610 Species:Homo sapiens


Alignment Length:318 Identity:65/318 - (20%)
Similarity:126/318 - (39%) Gaps:75/318 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 QIQKQETAIINGNYE---------HMTVNEFFVQLAQQYKHEQQLQALARENSSILRRKQSTTSR 138
            :|.|:..|:..||:|         .:.|.:...| |::.||::|::....||.   ::|:....:
Human   308 RINKRILALCMGNHELYMRRRKPDTIEVQQMKAQ-AREEKHQKQMERAMLENE---KKKREMAEK 368

  Fly   139 ESRDSQMTINNNNRQSETLSNRSSEYDNYQPSSSAGAGDMLVIGVAQQQAQQQPPLVKSAL---- 199
            |....:       |:.|.|..|..:.:.....             |||:.::|   .:.||    
Human   369 EKEKIE-------REKEELMERLKQIEEQTKK-------------AQQELEEQ---TRRALELEQ 410

  Fly   200 -KKRPTPTPSQMQYMRQQHQQ--QAHLAMNMNYQRSQPDV---ISMYSANSSNVATLRQPPQ--- 255
             :||......::...||:.::  :|.|..:.:.:::|..:   ::..:|..|.:...||..:   
Human   411 ERKRAQSEAEKLAKERQEAEEAKEALLQASRDQKKTQEQLALEMAELTARISQLEMARQKKESEA 475

  Fly   256 VAPQQQPIIVQCDKYYLSPTHQSYNEGGFIKSSQNIKKYVSP--MASPSNISYEQQQQRNPLHHQ 318
            |..||:..:||.|               ..|:...:|..:|.  :|.|:. :.:.:|..|.....
Human   476 VEWQQKAQMVQED---------------LEKTRAELKTAMSTPHVAEPAE-NEQDEQDENGAEAS 524

  Fly   319 RQL--DAISLAPSYVSVDMEAAQHQQQYRWRSQSHIAPLTPPQLGI-IEVKSHSSDML 373
            ..|  ||::...|......||.:::     |.|.|:..||...... .|.|..::||:
Human   525 ADLRADAMAKDRSEEERTTEAEKNE-----RVQKHLKALTSELANARDESKKTANDMI 577

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sstnNP_648745.1 None
MSNXP_011529261.1 B41 40..239 CDD:214604
FERM_N 42..104 CDD:286467
FERM_M 124..239 CDD:278785
FERM_C_ERM 233..329 CDD:270015 6/20 (30%)
ERM 380..610 CDD:279153 47/235 (20%)
TMPIT 416..>497 CDD:285135 16/95 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3529
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.