DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sstn and Frmd7

DIOPT Version :9

Sequence 1:NP_648745.1 Gene:sstn / 39643 FlyBaseID:FBgn0036476 Length:635 Species:Drosophila melanogaster
Sequence 2:NP_001177261.1 Gene:Frmd7 / 385354 MGIID:2686379 Length:703 Species:Mus musculus


Alignment Length:419 Identity:79/419 - (18%)
Similarity:135/419 - (32%) Gaps:126/419 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 QLAQQYKHEQQLQALARENSSILRRKQSTTSRESRDSQMTIN-------NNNRQSETL------- 157
            |...|| ||:|    .|.:..||    |..|::..|.::|..       |....||::       
Mouse   327 QYPSQY-HERQ----CRSSPDIL----SDVSKQVEDLRLTYGSSYYRNVNGVHASESMLDSRRRN 382

  Fly   158 -------------SNRSSEYDNYQPSSSAGAGDMLVIGVAQQQAQQQPPLVKSALKKRPTPTPSQ 209
                         |...:|..:..||.|:.:...:   .|.......|..::...::.|..:...
Mouse   383 SAVEVTFAAELEHSKPEAEATSLHPSQSSSSFTFI---YADPVFNTDPEPIEFFEERSPLSSFQT 444

  Fly   210 MQYMRQQHQQQAHLAMNMNYQ-------RSQ-----PDVISMYSANSSNVATLRQPPQVAPQQQP 262
            .......|..:|..|..:.|.       .||     |..:..|         :.:|||| |::..
Mouse   445 TSKFADSHTSKASPARQLTYTDVPYIPCTSQKVDIMPPQVFFY---------VDKPPQV-PRRSL 499

  Fly   263 IIVQCDKYYLSPTHQSYNEGGFIKSSQNIKKYVSPMASPSNISYEQQQQRNPLHHQRQLDAISLA 327
            |:.:.:   :.|  .||.:...||.::.         ||.|:..:..||  .|...::..|.:..
Mouse   500 IMAEEN---MRP--DSYVDHSAIKPAKR---------SPRNMRIKSLQQ--DLQELQEAMARTSG 548

  Fly   328 PSYVSVDMEA------------AQHQQQYRWRSQSHIAPLTPP------QLGIIEVKSHSSDMLA 374
            .|.::|:.|.            .|.|...|.:|||.:..:..|      .||.....:..:|:.|
Mouse   549 RSNINVEPEEEDPHLDDAFAYNLQEQTPKRSQSQSDMKTIRFPFGSEFRPLGPCPALTRKTDLFA 613

  Fly   375 VPMPPSRYPPHDEISLSSSSTTIEKKPKPKQWLESSLDGPAVIRQMD---------SQPHSPAGS 430
            .......:|          :..|::....:.....|.|..:.|.:.|         ..|.:....
Mouse   614 CTFAEQEFP----------TVLIDQSSAERYVASESSDSESEIIKPDYYFLYGKGTKSPRARIRL 668

  Fly   431 SNGS------------SNPGAAAMVSSKP 447
            |:||            :.|||......||
Mouse   669 SSGSLQLEEEDETISFATPGAEDRTLLKP 697

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sstnNP_648745.1 None
Frmd7NP_001177261.1 FERM_F1_FRMD7 1..86 CDD:340708
FERM_M 85..191 CDD:366056
FERM_C_FARP1-like 179..299 CDD:270014
FA 294..330 CDD:370090 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3529
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.