DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sstn and Frmd4b

DIOPT Version :9

Sequence 1:NP_648745.1 Gene:sstn / 39643 FlyBaseID:FBgn0036476 Length:635 Species:Drosophila melanogaster
Sequence 2:XP_038964692.1 Gene:Frmd4b / 252858 RGDID:620172 Length:1066 Species:Rattus norvegicus


Alignment Length:612 Identity:119/612 - (19%)
Similarity:196/612 - (32%) Gaps:231/612 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 KIEDDPKVRKENLEARKQALEQRLSEKSWLLQQIQKQETAIINGNYEHMTVNEFFVQLAQQYKHE 115
            |:..:|.:.|...:.|||.....:..    ||:|:.             ::||:.::..::...:
  Rat   519 KLASEPDLCKTVKKKRKQDYTDAVKR----LQEIEN-------------SINEYRIRCGKKPSQK 566

  Fly   116 QQL----QALARENSSILRRKQSTTSRESRDS-------------------------------QM 145
            ..:    ..:..|:||:   ..:||..:..||                               :.
  Rat   567 AAVVPPEDIIPSESSSL---SDTTTYDDPNDSFTLAGQRPSSVPHSPRILPPKSLGIERIHFRKS 628

  Fly   146 TINN---NNRQS-ETLSNRSSEYDNYQPSSSAGAGDMLVIGVAQQQAQQQPPLVKSALKKRPTPT 206
            :||.   :.||| |.||..||.|...:.....|           :.....|.|.::|........
  Rat   629 SINEQFVDTRQSREMLSTHSSPYKTLERRPQGG-----------RSMPTTPVLTRNAYSSSHLEP 682

  Fly   207 PSQMQYMRQQH---QQQAHLAMNMN----------YQRSQPDVI----SMYSANSS--------- 245
            .|..|:.||:.   :.|:||...|:          .|||....|    |.|::.||         
  Rat   683 DSSSQHCRQRSGSLESQSHLLSEMDSDKPFFTLSKSQRSSSTEILDDGSSYTSQSSSEYYCVTPA 747

  Fly   246 ----------------------------------NVA---TLRQ---------PPQ---VAPQQQ 261
                                              |:|   |||.         ||.   :|  ..
  Rat   748 AGPYYTTQTLDTRARGRRRSKKHSVSTSNSGSMPNLAQKDTLRNGVYSKGQDPPPSGYYIA--GY 810

  Fly   262 PIIVQCDKYYLSPTHQSYNEGGFIKSSQNIKKY-VSP-MASPSNISYEQQQQRNPLHHQRQLD-- 322
            |...:||.||         .||::..:....:| |:| ..|.::..|::|:..:...|:.::|  
  Rat   811 PPYAECDLYY---------SGGYVYENDTEGQYSVNPSYQSSAHYGYDRQRDYSRSFHEDEVDRV 866

  Fly   323 -----AISLAPSYVSVDME----------AAQH-----QQQYRWRSQSHIAPLTPPQLGIIEVKS 367
                 |....|...:|..|          .|:|     |:....:.|.| :|.|          |
  Rat   867 PHNPYATLRLPRKAAVKSEHITKNIHKAIVAEHLRGWYQRASGQKDQGH-SPQT----------S 920

  Fly   368 HSSDM----------LAVPMPPSRYPPHDEISLSSSSTTIEKKPKPKQWLESSLDGPAVIRQMDS 422
            ..||.          |.||..||        |.:||.:::........|......|   :.:.::
  Rat   921 FDSDRGSQRCLGFAGLQVPCSPS--------SRASSYSSVSSTNASGNWRTQLTTG---LSEYEN 974

  Fly   423 QPHSPAGSSNGS-SNP--------------GAAAMVSSKPRAKLSSQSMSVAGRHYSMSNQRPT- 471
            ..|||..|..|: .||              .....|:.:.|:.|||...|||.|:.:....|.| 
  Rat   975 PVHSPYTSYYGNIYNPLPSPNRHNHNRGPLWQRMAVAPEVRSVLSSVLFSVASRNSTQRALRWTV 1039

  Fly   472 ---PNYPSASYAVNTSSKALLSQSTSY 495
               .::.:|...||..|..:.:.|..:
  Rat  1040 QTETSWKTAWRVVNRGSFGMKTPSPEH 1066

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sstnNP_648745.1 None
Frmd4bXP_038964692.1 FERM_F1_FRMD4B 57..145 CDD:340720
B41 75..260 CDD:214604
FERM_C_FRMD4A_FRMD4B 256..366 CDD:270012
DUF3338 395..528 CDD:403120 2/8 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3529
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.