DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sstn and Nf2

DIOPT Version :9

Sequence 1:NP_648745.1 Gene:sstn / 39643 FlyBaseID:FBgn0036476 Length:635 Species:Drosophila melanogaster
Sequence 2:NP_035028.2 Gene:Nf2 / 18016 MGIID:97307 Length:596 Species:Mus musculus


Alignment Length:374 Identity:67/374 - (17%)
Similarity:135/374 - (36%) Gaps:101/374 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 SEKSWLLQQIQKQETAIINGNYEHMTVNEFFVQLA--------QQYKHE----QQLQALARENSS 127
            |:|.:.::.:.| :..:...|...:.||:..:||.        ::.|.:    ||::|.|||..:
Mouse   267 SDKEFTIKPLDK-KIDVFKFNSSKLRVNKLILQLCIGNHDLFMRRRKADSLEVQQMKAQAREEKA 330

  Fly   128 ILRRKQSTTSRESRDSQMTINNNNRQSE------------TLSN----RSSE-YDNYQPSSSAGA 175
               |||....|.:|:.||.......:.|            |::|    ||.| .|.....:....
Mouse   331 ---RKQMERQRLAREKQMREEAERTRDELERRLLQMKEEATMANEALMRSEETADLLAEKAQITE 392

  Fly   176 GDMLVIGVAQQQAQQQPPLVKSALKKRPTPTPSQMQYMRQQHQQQAHLAMNMNYQRSQPDVISMY 240
            .:..::.....:|:|:...:|:...:    |..:.:.|.|:..:...||:.|..:..:       
Mouse   393 EEAKLLAQKAAEAEQEMQRIKATAIR----TEEEKRLMEQKVLEAEVLALKMAEESER------- 446

  Fly   241 SANSSNVATLRQPPQVAPQ-----QQPIIVQCDKYYLSPTHQSYNEGGFIKSSQNIKKYVSPMAS 300
              .:.....|:|..|.|.:     :|.::....|    ||:...|.             :.|...
Mouse   447 --RAKEADQLKQDLQEAREAERRAKQKLLEIATK----PTYPPMNP-------------IPPPLP 492

  Fly   301 PSNISYEQQQQRNPLHHQRQLDAISLAPSYVSVD---------------MEAAQHQQQY--RWRS 348
            |...|::             :.|.||:..:...|               ||.::|.|:.  ..::
Mouse   493 PDIPSFD-------------IIADSLSFDFKDTDMKRLSMEIEKEKVEYMEKSKHLQEQLNELKT 544

  Fly   349 QSHIAPLTPPQLGIIEVKSHSSDMLAVPMPPSRYPPHDEISLSSSSTTI 397
            :.....|...:..:..:.|.|||...   |.|::....:::|.|:.:.:
Mouse   545 EIEALKLKERETALDVLHSESSDRGG---PSSKHNTIKKLTLQSAKSRV 590

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sstnNP_648745.1 None
Nf2NP_035028.2 B41 23..222 CDD:214604
FERM_N 26..87 CDD:286467
FERM_M 107..222 CDD:278785
FERM_C_ERM 216..312 CDD:270015 8/45 (18%)
ERM 347..596 CDD:279153 45/290 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 560..580 6/22 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3529
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.