DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or71a and Or94b

DIOPT Version :9

Sequence 1:NP_524078.2 Gene:Or71a / 39641 FlyBaseID:FBgn0036474 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_524456.1 Gene:Or94b / 42712 FlyBaseID:FBgn0039034 Length:383 Species:Drosophila melanogaster


Alignment Length:379 Identity:122/379 - (32%)
Similarity:201/379 - (53%) Gaps:30/379 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 GVLKW----------W--RLWPRKESVSTPDWTNWQAYALHVPFTFLFVLLLWLEAIKSRDIQHT 66
            |:|||          |  |::|               :.||:|.||.::.|:|.|||.|.|.:..
  Fly    21 GLLKWENEGEDGVLTWLKRIYP---------------FVLHLPLTFTYIALMWYEAITSSDFEEA 70

  Fly    67 ADVLLICLTTTALGGKVINIWKYAHVAQGILSEWSTWDLFELRSKQEVDMWRFEHRRFNRVFMFY 131
            ..||.:.:|..||..|::|||...|.|..::.|......|.||:.:|:..|:...|.|.|:|.:|
  Fly    71 GQVLYMSITELALVTKLLNIWYRRHEAASLIHELQHDPAFNLRNSEEIKFWQQNQRNFKRIFYWY 135

  Fly   132 CLCSAGVIPFIVIQPLFDIPNRLPFWMWTPFDWQQPVLFWYAFIYQATTIPIACACNVTMDAVNW 196
            ...|..|.....|...|.....|||..:.||:|:....::||:.|....:.:.|..|:.:|.:..
  Fly   136 IWGSLFVAVMGYISVFFQEDYELPFGYYVPFEWRTRERYFYAWGYNVVAMTLCCLSNILLDTLGC 200

  Fly   197 YLMLHLSLCLRMLGQRLSKLQH-DDKDLREKFLELIHLHQRLKQQALSIEIFISKSTFTQILVSS 260
            |.|.|::...|:||.||..|:: .::..|.:...:..||.::::.....|:.:|....:|::.|:
  Fly   201 YFMFHIASLFRLLGMRLEALKNAAEEKARPELRRIFQLHTKVRRLTRECEVLVSPYVLSQVVFSA 265

  Fly   261 LIICFTIYSMQMSPVLQDLPG-FAAMMQYLVAMIMQVMLPTIYGNAVIDSANMLTDSMYNSDWPD 324
            .||||:.|.: :....:..|| |...:|::..||:|:.||..|||.:...||.||:|::.::|.:
  Fly   266 FIICFSAYRL-VHMGFKQRPGLFVTTVQFVAVMIVQIFLPCYYGNELTFHANALTNSVFGTNWLE 329

  Fly   325 MNCRMRRLVLMFMVYLNRPVTLKAGGFFHIGLPLFTKTMNQAYSLLALLLNMNQ 378
            .:...|:|:..:|.:|.|||.::||.||.||||:|.||:|.|||..||||.:::
  Fly   330 YSVGTRKLLNCYMEFLKRPVKVRAGVFFEIGLPIFVKTINNAYSFFALLLKISK 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or71aNP_524078.2 7tm_6 68..367 CDD:251636 96/300 (32%)
Or94bNP_524456.1 7tm_6 66..372 CDD:251636 97/306 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471630
Domainoid 1 1.000 134 1.000 Domainoid score I10150
eggNOG 1 0.900 - - E1_2D4HZ
Homologene 1 1.000 - - H119629
Inparanoid 1 1.050 144 1.000 Inparanoid score I6873
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D326193at33208
OrthoFinder 1 1.000 - - FOG0014256
OrthoInspector 1 1.000 - - mtm9673
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.900

Return to query results.
Submit another query.