DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or71a and Or94a

DIOPT Version :9

Sequence 1:NP_524078.2 Gene:Or71a / 39641 FlyBaseID:FBgn0036474 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_524455.1 Gene:Or94a / 42711 FlyBaseID:FBgn0039033 Length:387 Species:Drosophila melanogaster


Alignment Length:390 Identity:143/390 - (36%)
Similarity:228/390 - (58%) Gaps:25/390 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DRIRPVRFLTGVLKWWRLWPRKESVSTPDWT-------NWQAYALHVPFTFLFVLLLWLEAIKSR 61
            |||..:|.:..|::.:.|||.... |..:||       |:: :.||:|.||.|:.|:||||..|.
  Fly     6 DRIESMRLILQVMQLFGLWPWSLK-SEEEWTFTGFVKRNYR-FLLHLPITFTFIGLMWLEAFISS 68

  Fly    62 DIQHTADVLLICLTTTALGGKVINIWKYAHVAQGILSEWSTWDLFELRSKQEVDMWRFEHRRFNR 126
            :::....||.:.:|..||..|:::||.|...|..::.|......::|.:::|||.||.|.|.|..
  Fly    69 NLEQAGQVLYMSITEMALVVKILSIWHYRTEAWRLMYELQHAPDYQLHNQEEVDFWRREQRFFKW 133

  Fly   127 VFMFYCLCSAGVIPFIVIQPLFDIPNRLPFWMWTPFDWQQPVLFWYAFIYQATTIPIACACNVTM 191
            .|..|.|.|.||:.......||.....|||..:.||:||....:|:|:.|....:.:.|..|:|:
  Fly   134 FFYIYILISLGVVYSGCTGVLFLEGYELPFAYYVPFEWQNERRYWFAYGYDMAGMTLTCISNITL 198

  Fly   192 DAVNWYLMLHLSLCLRMLGQRLSKLQHDDKD------LREKFLELIHLHQRLKQQALSIEIFISK 250
            |.:..|.:.|:||..|:||.||.:.::...|      ||..|:    :|||::...|:.:..:|.
  Fly   199 DTLGCYFLFHISLLYRLLGLRLRETKNMKNDTIFGQQLRAIFI----MHQRIRSLTLTCQRIVSP 259

  Fly   251 STFTQILVSSLIICFTIYSMQMSPVLQDLPG-FAAMMQYLVAMIMQVMLPTIYGNAVIDSANMLT 314
            ...:||::|:|||||:.|.:|...: :|.|| |.:|:|::..||:|:.||..|||.:...||.||
  Fly   260 YILSQIILSALIICFSGYRLQHVGI-RDNPGQFISMLQFVSVMILQIYLPCYYGNEITVYANQLT 323

  Fly   315 DSMYNSDWPDMNCR--MRRLVLMFMVYLNRPVTLKAGGFFHIGLPLFTKTMNQAYSLLALLLNMN 377
            :.:|:::|  :.||  :|:|:..:|.:|.:|||::||.||.:|||:|.||:|.|||.||||||::
  Fly   324 NEVYHTNW--LECRPPIRKLLNAYMEHLKKPVTIRAGNFFAVGLPIFVKTINNAYSFLALLLNVS 386

  Fly   378  377
              Fly   387  386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or71aNP_524078.2 7tm_6 68..367 CDD:251636 110/307 (36%)
Or94aNP_524455.1 7tm_6 69..376 CDD:251636 110/313 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471631
Domainoid 1 1.000 134 1.000 Domainoid score I10150
eggNOG 1 0.900 - - E1_2D4HZ
Homologene 1 1.000 - - H119629
Inparanoid 1 1.050 144 1.000 Inparanoid score I6873
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D326193at33208
OrthoFinder 1 1.000 - - FOG0014256
OrthoInspector 1 1.000 - - mtm9673
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.900

Return to query results.
Submit another query.