DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or71a and Or92a

DIOPT Version :9

Sequence 1:NP_524078.2 Gene:Or71a / 39641 FlyBaseID:FBgn0036474 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_524414.2 Gene:Or92a / 42425 FlyBaseID:FBgn0038798 Length:408 Species:Drosophila melanogaster


Alignment Length:301 Identity:63/301 - (20%)
Similarity:130/301 - (43%) Gaps:40/301 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 LSEWSTWDLFELRSKQEVDMWRFEHRRFNRV--------------FMFYCLCSAGVIPFIVIQPL 147
            |.|....|| |.:.|..|..:|   :..|||              |.||....:.:..:::...:
  Fly   118 LKEIFPLDL-EAQRKYNVSFYR---KHMNRVMTLFTILCMTYTSSFSFYPAIKSTIKYYLMGSEI 178

  Fly   148 FDIPNRLPFWMWTPFDWQQPV-LFWYAFIYQATTIPIACACNVTMDAVNWYLMLHLSLCLRMLGQ 211
            |:  ....|.:..|:|.:..: ::|:::...|....:|....|.:|.:....:..|::....:..
  Fly   179 FE--RNYGFHILFPYDAETDLTVYWFSYWGLAHCAYVAGVSYVCVDLLLIATITQLTMHFNFIAN 241

  Fly   212 RLSKLQ---HDDKDLREKFLELIHLHQR---LKQQALSIEIFISKSTFTQILVSSLIICFTIYSM 270
            .|...:   |.|::..:....|:..|.|   |.::..:|..|:....|   :.:||:|||..:.:
  Fly   242 DLEAYEGGDHTDEENIKYLHNLVVYHARALDLSEEVNNIFSFLILWNF---IAASLVICFAGFQI 303

  Fly   271 QMSPVLQDLPGFAAMMQYLV---AMIMQVMLPTIYGNAVIDSANMLTDSMYNSDWPDMNCRMRRL 332
            ..|.| :|:      :.|.:   |.::||.:...||:.:|.|::.:..|.:|.:|...:.:.:|:
  Fly   304 TASNV-EDI------VLYFIFFSASLVQVFVVCYYGDEMISSSSRIGHSAFNQNWLPCSTKYKRI 361

  Fly   333 VLMFMVYLNRPVTLKAGGFFHIGLPLFTKTMNQAYSLLALL 373
            :...:....:|.:::...|..|....|.|.::.:|...|||
  Fly   362 LQFIIARSQKPASIRPPTFPPISFNTFMKVISMSYQFFALL 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or71aNP_524078.2 7tm_6 68..367 CDD:251636 59/293 (20%)
Or92aNP_524414.2 7tm_6 80..396 CDD:251636 59/293 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466168
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.