DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or71a and Or88a

DIOPT Version :9

Sequence 1:NP_524078.2 Gene:Or71a / 39641 FlyBaseID:FBgn0036474 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_524348.2 Gene:Or88a / 41715 FlyBaseID:FBgn0038203 Length:401 Species:Drosophila melanogaster


Alignment Length:312 Identity:74/312 - (23%)
Similarity:124/312 - (39%) Gaps:73/312 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 DLFELRSKQEVDMWR--FEHRRFNRVFM-----FYCLCSAGVIP---FIVIQPLFDIP---NRLP 155
            ||......|..:.:|  ::..||.|::.     .:|     |:|   |::.....|.|   :...
  Fly   118 DLVSQLDMQMDETYRNFWQRYRFIRIYSHLGGPMFC-----VVPLALFLLTHEGKDTPVAQHEQL 177

  Fly   156 FWMWTPFDWQQPVLFW---YAFIYQATTIPIACACN--VTMDAVNWYLMLHLSLCLRMLGQRLSK 215
            ...|.|...::...|:   ::|....||    |..:  ||.|.:...:..||.:.|..|.::.|.
  Fly   178 LGGWLPCGVRKDPNFYLLVWSFDLMCTT----CGVSFFVTFDNLFNVMQGHLVMHLGHLARQFSA 238

  Fly   216 LQHDDKDLREK--FLELIHLHQRLKQQALS------IEIFISKSTFTQILVSSLI----ICFTIY 268
            :........||  |::|..|.||  ||.|:      .:||  |..|   |||:.:    :||.::
  Fly   239 IDPRQSLTDEKRFFVDLRLLVQR--QQLLNGLCRKYNDIF--KVAF---LVSNFVGAGSLCFYLF 296

  Fly   269 SM-QMSPVLQDLPGFAAMMQYLVAMIMQVMLPTIY-----------GNAVIDSANMLTDSMYNSD 321
            .: :.|.||               :|.|.:|||:.           |..:..::..|..|:.:.:
  Fly   297 MLSETSDVL---------------IIAQYILPTLVLVGFTFEICLRGTQLEKASEGLESSLRSQE 346

  Fly   322 WPDMNCRMRRLVLMFMVYLNRPVTLKAGGFFHIGLPLFTKTMNQAYSLLALL 373
            |...:.|.|:..|::..|..|...|.|.|...:.:..||:.|..||.|...|
  Fly   347 WYLGSRRYRKFYLLWTQYCQRTQQLGAFGLIQVNMVHFTEIMQLAYRLFTFL 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or71aNP_524078.2 7tm_6 68..367 CDD:251636 70/304 (23%)
Or88aNP_524348.2 7tm_6 75..392 CDD:251636 70/304 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466200
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.