DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or71a and Or85b

DIOPT Version :9

Sequence 1:NP_524078.2 Gene:Or71a / 39641 FlyBaseID:FBgn0036474 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_524279.2 Gene:Or85b / 41007 FlyBaseID:FBgn0037590 Length:390 Species:Drosophila melanogaster


Alignment Length:372 Identity:79/372 - (21%)
Similarity:153/372 - (41%) Gaps:50/372 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 WTNWQAYALHVPFTFLF-VLLLWLEAIKSRDIQHTADVLLICLTTTALGGKVINIWKYAHVAQGI 96
            |:|    .:::.|..|| .:.::...:.::.::....:..|...|..:.......||...:.:.|
  Fly    38 WSN----VINLSFVGLFESIYVYSAFMDNKFLEAVTALSYIGFVTVGMSKMFFIRWKKTAITELI 98

  Fly    97 LSEWSTWDLFELRSKQEVDMWRFEHRRFN---------RVFMFYCLCSAGVI----PFIVIQP-L 147
                     .||:......:.|.|  |:|         |:.:.|.|..:.:|    .|.|::. :
  Fly    99 ---------NELKEIYPNGLIREE--RYNLPMYLGTCSRISLIYSLLYSVLIWTFNLFCVMEYWV 152

  Fly   148 FD-------IPNRLPFWMWTPFDWQQ-----PVLFWYAFI-YQATTIPIACACNVTMDAVNWYLM 199
            :|       :..:||:.|:.|:.||.     |:||...|. |.:....|  :.:|.:.||...|:
  Fly   153 YDKWLNIRVVGKQLPYLMYIPWKWQDNWSYYPLLFSQNFAGYTSAAGQI--STDVLLCAVATQLV 215

  Fly   200 LHLSLCLRMLGQRLSKLQHDDKDLREKFLELIHLHQRLKQQALSIEIFISKSTFTQILVSSLIIC 264
            :|.......:.:.  :|..|.|......::::..|:|:.:.:.::............:|||.:||
  Fly   216 MHFDFLSNSMERH--ELSGDWKKDSRFLVDIVRYHERILRLSDAVNDIFGIPLLLNFMVSSFVIC 278

  Fly   265 FTIYSMQMSPVLQDLPGFAAMMQYLVAMIMQVMLPTIYGNAVIDSANMLTDSMYNSDWPDMNCRM 329
            |..:.|.:. |..|:  ...:..:||:.:.||.|...||..|.|::...:.:.||..|...:.|.
  Fly   279 FVGFQMTVG-VPPDI--VVKLFLFLVSSMSQVYLICHYGQLVADASYGFSVATYNQKWYKADVRY 340

  Fly   330 RRLVLMFMVYLNRPVTLKAGGFFHIGLPLFTKTMNQAYSLLALLLNM 376
            :|.:::.:....:...|||..|..|.....|..:..:|...|||..|
  Fly   341 KRALVIIIARSQKVTFLKATIFLDITRSTMTDLLQISYKFFALLRTM 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or71aNP_524078.2 7tm_6 68..367 CDD:251636 69/325 (21%)
Or85bNP_524279.2 7tm_6 64..378 CDD:251636 69/331 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466176
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.