DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or71a and Or83a

DIOPT Version :9

Sequence 1:NP_524078.2 Gene:Or71a / 39641 FlyBaseID:FBgn0036474 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_524234.2 Gene:Or83a / 40648 FlyBaseID:FBgn0037322 Length:453 Species:Drosophila melanogaster


Alignment Length:411 Identity:84/411 - (20%)
Similarity:149/411 - (36%) Gaps:88/411 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 YALHVPFTFLFVLLLWLEAIKSRDIQHTADVLLICLTTTALGGKVINIWKYA----------HVA 93
            |.|...|..:.:..|::..|.....|...|..:.||..|     :|.:|..|          .:.
  Fly    56 YELFNYFVSVHIAGLYICTIYINYGQGDLDFFVNCLIQT-----IIYLWTIAMKLYFRRFRPGLL 115

  Fly    94 QGILSEWSTWDLFELRSKQEVDMWRFE-HRRFNRVFM---FYCLCSAGVIPFIVIQPLFDIPNRL 154
            ..|||..:  |.:|.||.......... ..|.:::::   .|| |..|.| |.:..|:......|
  Fly   116 NTILSNIN--DEYETRSAVGFSFVTMAGSYRMSKLWIKTYVYC-CYIGTI-FWLALPIAYRDRSL 176

  Fly   155 PFWMWTPFDWQQPVLFWYAFIYQAT-TIPIACACNVTMDAVNWYLMLHLSLCLRMLGQ------- 211
            |...|.|||:.||.::...|:.||. .|.:|.:...:..       ||:.||:.:.||       
  Fly   177 PLACWYPFDYTQPGVYEVVFLLQAMGQIQVAASFASSSG-------LHMVLCVLISGQYDVLFCS 234

  Fly   212 -----------------RLSKLQ-----------------HDDKDLRE----------------K 226
                             .|::||                 .::..|:|                .
  Fly   235 LKNVLASSYVLMGANMTELNQLQAEQSAADVEPGQYAYSVEEETPLQELLKVGSSMDFSSAFRLS 299

  Fly   227 FLELIHLHQRLKQQALSIEIFISKSTFTQILVSSLIICFTIYSMQMSPVLQDLPGFAAMMQYLVA 291
            |:..|..|:.:......||.|.|...|.:|...:.::|...:....|..........::.|||:.
  Fly   300 FVRCIQHHRYIVAALKKIESFYSPIWFVKIGEVTFLMCLVAFVSTKSTAANSFMRMVSLGQYLLL 364

  Fly   292 MIMQVMLPTIYGNAVIDSANMLTDSMYNSDWPDMNCRMRRLVLMFMVYLNRPVTLKAGGFFHIGL 356
            ::.::.:...:.:.|..::....::::.|.|......:|...:.||:...|...|.||...::.:
  Fly   365 VLYELFIICYFADIVFQNSQRCGEALWRSPWQRHLKDVRSDYMFFMLNSRRQFQLTAGKISNLNV 429

  Fly   357 PLFTKTMNQAYSLLALLLNMN 377
            ..|..|:..|:|.|.||..|:
  Fly   430 DRFRGTITTAFSFLTLLQKMD 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or71aNP_524078.2 7tm_6 68..367 CDD:251636 72/370 (19%)
Or83aNP_524234.2 7tm_6 <155..440 CDD:251636 57/293 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.