DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or71a and Or67a

DIOPT Version :9

Sequence 1:NP_524078.2 Gene:Or71a / 39641 FlyBaseID:FBgn0036474 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_524005.2 Gene:Or67a / 39109 FlyBaseID:FBgn0036009 Length:407 Species:Drosophila melanogaster


Alignment Length:272 Identity:59/272 - (21%)
Similarity:125/272 - (45%) Gaps:25/272 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 FNRVFMFYCLCSAGVIPFIV--IQPLF----DIPNRLPFWMWTPFDWQQPVLFWYAFIYQATTIP 182
            |..:||......| :||..:  ||.:.    |....:||:...|::::...||:.::.:|::...
  Fly   144 FGGLFMIMYFAHA-LIPLFIYFIQRVLLHYPDAKQIMPFYQLEPWEFRDSWLFYPSYFHQSSAGY 207

  Fly   183 IACACNVTMD----AVNWYLMLHLSLCLRMLGQRLSKLQ-HD-----DKDLREKFLELIHLH-QR 236
            .|...::..|    ||...:::|.....::|  |..|:| |:     .:|:| |...|:..| ..
  Fly   208 TATCGSIAGDLMIFAVVLQVIMHYERLAKVL--REFKIQAHNAPNGAKEDIR-KLQSLVANHIDI 269

  Fly   237 LKQQALSIEIFISKSTFTQILVSSLIICFTIYSMQMSPVLQDLPGFAAMMQYLVAMIMQVMLPTI 301
            |:...|..|:| ........:.|:|::|  :..:|::..|.. ..|...|.:|::::::|.|...
  Fly   270 LRLTDLMNEVF-GIPLLLNFIASALLVC--LVGVQLTIALSP-EYFCKQMLFLISVLLEVYLLCS 330

  Fly   302 YGNAVIDSANMLTDSMYNSDWPDMNCRMRRLVLMFMVYLNRPVTLKAGGFFHIGLPLFTKTMNQA 366
            :...:||::..:..:.|:.||...:.|.:::::...:...:||.|||.....:.:|..:..:..:
  Fly   331 FSQRLIDASENVGHAAYDMDWLGSDKRFKKILIFISMRSQKPVCLKATVVLDLSMPTMSIFLGMS 395

  Fly   367 YSLLALLLNMNQ 378
            |.....:..|.|
  Fly   396 YKFFCAVRTMYQ 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or71aNP_524078.2 7tm_6 68..367 CDD:251636 56/259 (22%)
Or67aNP_524005.2 7tm_6 75..396 CDD:251636 56/259 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466188
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.