DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or71a and Or63a

DIOPT Version :9

Sequence 1:NP_524078.2 Gene:Or71a / 39641 FlyBaseID:FBgn0036474 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_523895.2 Gene:Or63a / 38354 FlyBaseID:FBgn0035382 Length:420 Species:Drosophila melanogaster


Alignment Length:404 Identity:84/404 - (20%)
Similarity:151/404 - (37%) Gaps:72/404 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RLWPRKESVST--PDWTNWQAYALHVPFTFLFVLLLWLEAIKSRDIQ---HTADVLLICLTTTAL 79
            |:|....|||:  ..:.:||..|.::                 .||.   .||...|..||:.| 
  Fly    43 RIWTIVLSVSSLASLYGHWQMLARYI-----------------HDIPRIGETAGTALQFLTSIA- 89

  Fly    80 GGKVINIW--KYAH----------VAQGILSEWSTWD-------LFELRSKQEVDMWRF--EHRR 123
                 .:|  .:||          ....:|.:...::       :.|:|.:.|..|.|:  ..||
  Fly    90 -----KMWYFLFAHRQIYELLRKARCHELLQKCELFERMSDLPVIKEIRQQVESTMNRYWASTRR 149

  Fly   124 FNRVFMFYCLC---SAGVIPFIV------IQP------LFDIPNRLPFWMWTPFDWQQPVLFWYA 173
            ...::::.|:|   :..:..|::      .:|      :..:|:..|.|.....::.    :::.
  Fly   150 QILIYLYSCICITTNYFINSFVINLYRYFTKPKGSYDIMLPLPSLYPAWEHKGLEFP----YYHI 210

  Fly   174 FIYQATTIPIACA-CNVTMDAVNWYLMLHLSLCLRMLGQRLSKLQHD--DKDLREKFLE-LIHLH 234
            .:|..|.....|. |.|:.|.|...|.||....:|.|.|.:.:...:  ..|.|.::|. .|:.:
  Fly   211 QMYLETCSLYICGMCAVSFDGVFIVLCLHSVGLMRSLNQMVEQATSELVPPDRRVEYLRCCIYQY 275

  Fly   235 QRLKQQALSIEIFISKSTFTQILVSSLIICFTIYSMQMSPVLQDLPGFAAMMQYLVAMIMQVMLP 299
            ||:...|..:.......||||.|:|.......::.|.:............|..||||...|:::.
  Fly   276 QRVANFATEVNNCFRHITFTQFLLSLFNWGLALFQMSVGLGNNSSITMIRMTMYLVAAGYQIVVY 340

  Fly   300 TIYGNAVIDSANMLTDSMYNSDWPDMNCRMRRLVLMFMVYLNRPVTLKAGGFFHIGLPLFTKTMN 364
            ...|.....::..:.::.|...|...:...|.|:.|.::..||...|....|..:.||.....:.
  Fly   341 CYNGQRFATASEEIANAFYQVRWYGESREFRHLIRMMLMRTNRGFRLDVSWFMQMSLPTLMAMVR 405

  Fly   365 QAYSLLALLLNMNQ 378
            .:.....||.|:||
  Fly   406 TSGQYFLLLQNVNQ 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or71aNP_524078.2 7tm_6 68..367 CDD:251636 67/338 (20%)
Or63aNP_523895.2 7tm_6 76..408 CDD:251636 69/341 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465453
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.