DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or71a and Or59a

DIOPT Version :9

Sequence 1:NP_524078.2 Gene:Or71a / 39641 FlyBaseID:FBgn0036474 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_523821.1 Gene:Or59a / 37711 FlyBaseID:FBgn0026384 Length:379 Species:Drosophila melanogaster


Alignment Length:399 Identity:95/399 - (23%)
Similarity:149/399 - (37%) Gaps:74/399 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 WRLWPRKESVSTPDWTNWQ-AYALHVPFTFLFVLL-----LWLEAIKSRDIQHTADVLLIC--LT 75
            |..| |...|:.....||: .|..:...:.|.|.|     |.:...::|.|  |.|:|.:.  .|
  Fly    16 WTAW-RYLGVAHFRVENWKNLYVFYSIVSNLLVTLCYPVHLGISLFRNRTI--TEDILNLTTFAT 77

  Fly    76 TTALGGKVINIWKYAHVAQGILSEWSTWDLFELR-----SKQEVDMWRFEHRRFNRVFM-FYCLC 134
            .||...|.:   .||:..:.:|.......|.:.|     .:......|.:.|....||: .|..|
  Fly    78 CTACSVKCL---LYAYNIKDVLEMERLLRLLDERVVGPEQRSIYGQVRVQLRNVLYVFIGIYMPC 139

  Fly   135 SAGVIPFIVIQPLFDIPNRLPFWMWTPFDWQQPVLFWY-AFIYQATTIPIACACNVTMDAVNWYL 198
            :.    |..:..||.....|.:..|.||||......:| |..||...|......|...|.....:
  Fly   140 AL----FAELSFLFKEERGLMYPAWFPFDWLHSTRNYYIANAYQIVGISFQLLQNYVSDCFPAVV 200

  Fly   199 MLHLSLCLRMLGQRLSKLQHDDKDLREKFLE-LIHLHQRLKQQALSIEIFISKSTFTQILVSSLI 262
            :..:|..::||..|..::..|.....||.|| .|..|:.:.:....||.|||.....|..|::|.
  Fly   201 LCLISSHIKMLYNRFEEVGLDPARDAEKDLEACITDHKHILELFRRIEAFISLPMLIQFTVTALN 265

  Fly   263 ICFTIYSMQMSPVLQDLPGFAAM-------------MQYLVAMIMQVMLPTIYGNAVIDSANMLT 314
            :|.               |.||:             :.|.:||.:|:.....:|          |
  Fly   266 VCI---------------GLAALVFFVSEPMARMYFIFYSLAMPLQIFPSCFFG----------T 305

  Fly   315 DSMY----------NSDWPDMNCRMRRLVLMFMVYLNRPVTLKAGGFFHIGLPLFTKTMNQAYSL 369
            |:.|          :.:|...|...:|.:::|:....:..|..|||...|.|..|..|:..||||
  Fly   306 DNEYWFGRLHYAAFSCNWHTQNRSFKRKMMLFVEQSLKKSTAVAGGMMRIHLDTFFSTLKGAYSL 370

  Fly   370 LALLLNMNQ 378
            ..:::.|.:
  Fly   371 FTIIIRMRK 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or71aNP_524078.2 7tm_6 68..367 CDD:251636 76/331 (23%)
Or59aNP_523821.1 7tm_6 64..368 CDD:251636 78/337 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466041
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D326193at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.