DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or71a and Or56a

DIOPT Version :9

Sequence 1:NP_524078.2 Gene:Or71a / 39641 FlyBaseID:FBgn0036474 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_523796.2 Gene:Or56a / 37269 FlyBaseID:FBgn0034473 Length:419 Species:Drosophila melanogaster


Alignment Length:367 Identity:60/367 - (16%)
Similarity:131/367 - (35%) Gaps:115/367 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 QAYALHVPFTFLFVLLLWLEAIKSRDIQHTADVLLICLTTTALGGKVINIWKYAH-VAQGILSEW 100
            |||      |....||:|:.::                        :..:..|:. :.:.:....
  Fly   132 QAY------TRTITLLIWIPSV------------------------IAGLMAYSDCIYRSLFLPK 166

  Fly   101 STWDLFELRSKQEVDMWRFEHRRFNRVFMFYCLCSAGVIPFIVIQPLFDIPNRLPFWMWTPFDWQ 165
            |.:::..:|..:|..:..|:      :|.|..||...|:.::                       
  Fly   167 SVFNVPAVRRGEEHPILLFQ------LFPFGELCDNFVVGYL----------------------- 202

  Fly   166 QPVLFWYAFIYQATTIPIACACNVTMDAVNWY-----LMLHLSLCLRMLGQRLSKLQHDDKDLRE 225
            .|   |||.....|.||:            |:     ||.:::|.|::|.:|:.::  |...|..
  Fly   203 GP---WYALGLGITAIPL------------WHTFITCLMKYVNLKLQILNKRVEEM--DITRLNS 250

  Fly   226 K------------------FLELIHLHQRLKQQALSIEIFISKSTFTQILVSSLIICFTIYSMQM 272
            |                  |.|.:....|:::....::..|........::.|::|||..:::.:
  Fly   251 KLVIGRLTASELTFWQMQLFKEFVKEQLRIRKFVQELQYLICVPVMADFIIFSVLICFLFFALTV 315

  Fly   273 SPVLQDLPGFAAMMQYLVAMIMQVMLPTI------YGNAVIDSANMLTDSMYNSDWPDMNCRMRR 331
                    |..:.|.|....|...::..|      :...:::..:.|:.:.::..|.:....:::
  Fly   316 --------GVPSKMDYFFMFIYLFVMAGILWIYHWHATLIVECHDELSLAYFSCGWYNFEMPLQK 372

  Fly   332 LVLMFMVYLNRPVTLKAGGFFHIGLPLFTKTMNQAYSLLALL 373
            :::..|::..||:.::| ....:.|..|......|||...||
  Fly   373 MLVFMMMHAQRPMKMRA-LLVDLNLRTFIDIGRGAYSYFNLL 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or71aNP_524078.2 7tm_6 68..367 CDD:251636 48/328 (15%)
Or56aNP_523796.2 7tm_6 126..407 CDD:251636 55/359 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.