DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or71a and Or35a

DIOPT Version :9

Sequence 1:NP_524078.2 Gene:Or71a / 39641 FlyBaseID:FBgn0036474 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_723916.1 Gene:Or35a / 34918 FlyBaseID:FBgn0028946 Length:409 Species:Drosophila melanogaster


Alignment Length:308 Identity:55/308 - (17%)
Similarity:120/308 - (38%) Gaps:64/308 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 KQEVDMWRFEHRRFNRVFMFYCLCSA---GVIPFIVIQPLFDIPNRLPFWMWT---PFDWQQPVL 169
            ::|.:|:    |:.:...:...|.||   .||...:|.|:|.|.|:...::::   ||| ..|: 
  Fly   121 RKEPEMF----RKVDGKMIINRLVSAMYGAVISLYLIAPVFSIINQSKDFLYSMIFPFD-SDPL- 179

  Fly   170 FWYAFIYQATTIPIACA---CNVTMDAVNW-------YLMLHLS----LCLRMLGQRLSKL---- 216
              |.|      :|:...   ..:.:|.:.:       .|::||:    |..|.|...:.|:    
  Fly   180 --YIF------VPLLLTNVWVGIVIDTMMFGETNLLCELIVHLNGSYMLLKRDLQLAIEKILVAR 236

  Fly   217 --QHDDKDLREKFLELIHLHQRLKQQALSIEIFISKSTFTQILVSSLIICFTIYSMQMSPVLQDL 279
              .|..|.|:....:.:..:..|.|....:|...:...|.....::.::|...:....:|     
  Fly   237 DRPHMAKQLKVLITKTLRKNVALNQFGQQLEAQYTVRVFIMFAFAAGLLCALSFKAYTNP----- 296

  Fly   280 PGFAAMMQYLVAM-----IMQVMLPTIYGNAVIDSANMLTDSMYNSDW---------PDMNCRMR 330
                 |..|:.|:     .::::.....|:.:..:.:.|:...|.:.|         |..|.|:.
  Fly   297 -----MANYIYAIWFGAKTVELLSLGQIGSDLAFTTDSLSTMYYLTHWEQILQYSTNPSENLRLL 356

  Fly   331 RLVLMFMVYLNRPVTLKAGGFFHIGLPLFTKTMNQAYSLLALLLNMNQ 378
            :|:.:.:...::|..:....:|.:.|....|.:..::|....|.:|.:
  Fly   357 KLINLAIEMNSKPFYVTGLKYFRVSLQAGLKILQASFSYFTFLTSMQR 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or71aNP_524078.2 7tm_6 68..367 CDD:251636 52/295 (18%)
Or35aNP_723916.1 7tm_6 74..393 CDD:251636 52/295 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466204
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.