DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or71a and Or22b

DIOPT Version :9

Sequence 1:NP_524078.2 Gene:Or71a / 39641 FlyBaseID:FBgn0036474 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_477425.1 Gene:Or22b / 33336 FlyBaseID:FBgn0026397 Length:397 Species:Drosophila melanogaster


Alignment Length:416 Identity:78/416 - (18%)
Similarity:151/416 - (36%) Gaps:98/416 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 PRKESVSTPD-------------WT-----NWQA-YALHVPFTFLFVLLLWLEAIKSRDIQHTAD 68
            |..|.|.:.|             ||     .|.. |.|...|..|.:.:|...::....||... 
  Fly    13 PLSERVKSRDAFVYLDRVMWSFGWTVPENKRWDLHYKLWSTFVTLLIFILLPISVSVEYIQRFK- 76

  Fly    69 VLLICLTTTA---LGGKVINIWKYAHVAQGILSEWSTWDLFELRSKQEVDMWRFE---------- 120
                  |.:|   |....|.:..|....:..|:      :...:.:||..|...|          
  Fly    77 ------TFSAGEFLSSIQIGVNMYGSSFKSYLT------MMGYKKRQEAKMSLDELDKRCVCDEE 129

  Fly   121 ----HRRF---NRVFMFYCLCSAGVIPFIVIQPLFDIPNRLPFW-MWTPFDWQQPVLF------- 170
                ||..   |..::||.:....   |::...|..|..|:..| |:.|:...:...:       
  Fly   130 RTIVHRHVALGNFCYIFYHIAYTS---FLISNFLSFIMKRIHAWRMYFPYVDPEKQFYISSIAEV 191

  Fly   171 ----WYAFIYQATTI-----PIACACNVTMDAVNWYLMLHLSLCLRMLGQRLSKLQHDDKDLREK 226
                |..|:...|.:     .:...|::|                 :|.|||..|:.:.....::
  Fly   192 ILRGWAVFMDLCTDVCPLISMVIARCHIT-----------------LLKQRLRNLRSEPGRTEDE 239

  Fly   227 FL----ELIHLHQRLKQQALSIEIFISKSTFTQILVSSLIICFTIYSMQMSPVLQDLPGFAAMMQ 287
            :|    :.:..|:.:.....::....|.:.|.|.|:..:::..::.::.....|.  .|.|.:: 
  Fly   240 YLKELADCVRDHRLILDYVDALRSVFSGTIFVQFLLIGIVLGLSMINIMFFSTLS--TGVAVVL- 301

  Fly   288 YLVAMIMQVMLPTIY-GNAVIDSANMLTDSMYNSDWPDMNCRMRRLVLMFMVYLNRPVTLKAGGF 351
            ::..:.||. .|..| .|.::|....:.||::.|||...:.|.:..::.|:..|.:|:.|.|||.
  Fly   302 FMSCVSMQT-FPFCYLCNMIMDDCQEMADSLFQSDWTSADRRYKSTLVYFLHNLQQPIILTAGGV 365

  Fly   352 FHIGLPLFTKTMNQAYSLLALLLNMN 377
            |.|.:......:..|::::.::...|
  Fly   366 FPISMQTNLNMVKLAFTVVTIVKQFN 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or71aNP_524078.2 7tm_6 68..367 CDD:251636 62/340 (18%)
Or22bNP_477425.1 7tm_6 81..381 CDD:251636 60/329 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466105
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D326193at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.