DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or71a and Or65b

DIOPT Version :9

Sequence 1:NP_524078.2 Gene:Or71a / 39641 FlyBaseID:FBgn0036474 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_729162.3 Gene:Or65b / 318012 FlyBaseID:FBgn0041624 Length:406 Species:Drosophila melanogaster


Alignment Length:283 Identity:55/283 - (19%)
Similarity:116/283 - (40%) Gaps:58/283 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 WRFEHRRFNRVFMFYCLCSAGVIPFIVIQPLFDIPNRLPFWMWTPFDWQQ----PVLFWYAFIYQ 177
            |.|          |.|:    ::..::..|::.....|||....||.|.:    |:.....:::|
  Fly   153 WSF----------FLCI----LLLLLITSPMWVHQQNLPFHAAFPFQWHEKSLHPISHAIIYLFQ 203

  Fly   178 ATTIPIACACNVTMDAVNWYLMLH-LSLC--------LRMLGQRLSKLQHDDKDLREKFLE---L 230
            :.   .|..|      :.|.|.:. ||:|        :.:|...|.::...:..|:|..:|   |
  Fly   204 SY---FAVYC------LTWLLCIEGLSICIYAEITFGIEVLCLELRQIHRHNYGLQELRMETNRL 259

  Fly   231 IHLHQRLKQQALSIEIF-ISKSTFTQILVSSLIICFTIYSMQMSPVLQDLPGFAAMMQYLVAMIM 294
            :.|||::      :||. .:...|...|:..:.:.|::.|:.:...::.......:.|:.|.|::
  Fly   260 VKLHQKI------VEILDRTNDVFHGTLIMQMGVNFSLVSLSVLEAVEARKDPKVVAQFAVLMLL 318

  Fly   295 ---QVMLPTIYGNAVIDSANMLTDSMYNSDWPDMNCR--MRRLVLMFMVYLNR---PVTLKAGGF 351
               .:.:.:..|:.:...:..::::.|.:..|....:  .|.|    .|.:.|   |:.::|..|
  Fly   319 ALGHLSMWSYCGDQLSQKSLQISEAAYEAYDPTKGSKDVYRDL----CVIIRRGQDPLIMRASPF 379

  Fly   352 FHIGLPLFTKTMNQAYSLLALLL 374
            ....|..::..:||.|.:|..||
  Fly   380 PSFNLINYSAILNQCYGILTFLL 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or71aNP_524078.2 7tm_6 68..367 CDD:251636 51/274 (19%)
Or65bNP_729162.3 7tm_6 83..395 CDD:251636 51/274 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465465
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.