DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or71a and Or65a

DIOPT Version :9

Sequence 1:NP_524078.2 Gene:Or71a / 39641 FlyBaseID:FBgn0036474 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_729161.1 Gene:Or65a / 318011 FlyBaseID:FBgn0041625 Length:417 Species:Drosophila melanogaster


Alignment Length:345 Identity:66/345 - (19%)
Similarity:136/345 - (39%) Gaps:57/345 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 RDIQHTADVLLICLTTTALGGKVINIWKYAHVAQGILS------EWSTWDLFELRSKQEVDMWRF 119
            ||:.....::.||.       :::...:||.....|:.      .||    .:..:.:||.    
  Fly    97 RDLVFIITIIFICF-------RLVFFAQYAGELDVIIDALEDIYHWS----IKGPATKEVQ---- 146

  Fly   120 EHRRFNRVFMFYCLCSAGVIPFIVIQPLFDIPNRLPFWMWT---PF--DW--------QQPVLFW 171
            |.:|.:  |:.:.........|:::..|..|..  |||:.:   ||  .|        :.|:.:.
  Fly   147 ETKRLH--FLLFMALIITWFSFLILFMLIKIST--PFWIESQTLPFHVSWPFQLHDPSKHPIAYI 207

  Fly   172 YAFIYQATTIPIACACNVTMDAVNWYLMLHLSLCLRMLGQRLSKLQH----DDKDLREKFLELIH 232
            ..|:.|:||:.........::.:...|...|:..||:|...|..||.    |:..|..:...:..
  Fly   208 IIFVSQSTTMLYFLIWLGVVENMGVSLFFELTSALRVLCIELRNLQELCLGDEDMLYRELCRMTK 272

  Fly   233 LHQRLKQQALSIEIFIS---KSTFTQILVSSLIICFTIYSMQMSPVLQDLPGFAAMMQYLVAMIM 294
            .||::        |.::   ...|....:..::|.|.:.|:.:..||.........::|::.|:|
  Fly   273 FHQQI--------ILLTDRCNHIFNGAFIMQMLINFLLVSLSLFEVLAAKKNPQVAVEYMIIMLM 329

  Fly   295 ---QVMLPTIYGNAVIDSANMLTDSMYNSDWPDMNCR-MRRLVLMFMVYLNRPVTLKAGGFFHIG 355
               .:...:.:|:.....:..:..::|.:..|::..: :.|....|:....:|:.:||..|....
  Fly   330 TLGHLSFWSKFGDMFSKESEQVALAVYEAYDPNVGSKSIHRQFCFFIQRAQKPLIMKASPFPPFN 394

  Fly   356 LPLFTKTMNQAYSLLALLLN 375
            |..:...:.|.||:|.:|.|
  Fly   395 LENYMFILKQCYSILTILAN 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or71aNP_524078.2 7tm_6 68..367 CDD:251636 59/328 (18%)
Or65aNP_729161.1 7tm_6 145..406 CDD:251636 51/276 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45465469
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21137
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.