DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sytbeta and SYT3

DIOPT Version :9

Sequence 1:NP_648734.1 Gene:Sytbeta / 39630 FlyBaseID:FBgn0261090 Length:602 Species:Drosophila melanogaster
Sequence 2:NP_001153800.1 Gene:SYT3 / 84258 HGNCID:11511 Length:590 Species:Homo sapiens


Alignment Length:529 Identity:157/529 - (29%)
Similarity:226/529 - (42%) Gaps:117/529 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 PASQLHGMHGGMGLNHHHMGTVSATGTDILRGPAEVFHSPLHLHHQSRSFPPRLQ---------- 181
            |...|.|:.||.|   ||: .....|..:|.||        |.|..:...||..:          
Human   102 PGVGLAGLVGGGG---HHL-AAGLGGHPLLGGP--------HHHAHAAHHPPFAELLEPGSLGGS 154

  Fly   182 RTPSISSQSSVDSAPSR-----HSGHRGS--SPQIRTFGPDGRSSL---PSEPGFP----HHLAR 232
            .||. .|...:||.|..     .:|.:.|  ||::.:.|..|...|   ||..|.|    |....
Human   155 DTPE-PSYLDMDSYPEAAAAAVAAGVKPSQTSPELPSEGGAGSGLLLLPPSGGGLPSAQSHQQVT 218

  Fly   233 S----------PSPMRTISLDARCGSPAHSADPGDLRTPSPSQSSLASLAG--------GSGMGG 279
            |          |.|:...:|.:: ..|:....|..|..|.|.....|.|.|        |:|.||
Human   219 SLAPTTRYPALPRPLTQQTLTSQ-PDPSSEERPPALPLPLPGGEEKAKLIGQIKPELYQGTGPGG 282

  Fly   280 SSAGKGVAGGRCLSPLLIPPRSQPGVDPAMGPASPLGALQPDLYRMPDGPVYLTAPESSHAVGRL 344
            ..:|.|...|..                  |..:|                          .||:
Human   283 RRSGGGPGSGEA------------------GTGAP--------------------------CGRI 303

  Fly   345 HLRVKYDYHLFDLTVHLIEAHNLSPIEEGGFRDPYVRLMLQPEVDSRKRQTHIHRGESNPYFDQH 409
            ...::|.|....|.|.:::|.:|...:..||.||||::.|.|: ..:|.||.:||...||.|::.
Human   304 SFALRYLYGSDQLVVRILQALDLPAKDSNGFSDPYVKIYLLPD-RKKKFQTKVHRKTLNPVFNET 367

  Fly   410 FKFPVSRDQLQGKELILQVLDYDRYSHNDIIGEVRISVDGLDLSKSV---EIWGDLLRTKKPKED 471
            |:|.|...:|..::|...|.|:||:|.:|:||:|.:. :.|:|::..   .:|.|::.....|.|
Human   368 FQFSVPLAELAQRKLHFSVYDFDRFSRHDLIGQVVLD-NLLELAEQPPDRPLWRDIVEGGSEKAD 431

  Fly   472 RPELLCSLNYLPQAERLTVVIMKARNLDTL-----QEPYVKIYLIQNGKRIKKKKTSITKSDDPT 531
            ..||..||.|||.|.||||.|:||.||..:     .:||||..||..|:|:||:||||.|  :..
Human   432 LGELNFSLCYLPTAGRLTVTIIKASNLKAMDLTGFSDPYVKASLISEGRRLKKRKTSIKK--NTL 494

  Fly   532 NPIWNEAFTFNLQSNYLHNAAIEIYVVG---AGSEATEIGCCGLGPQESGT-GCQHWHDMINNAR 592
            ||.:|||..|::....:.|..:.|.||.   .|.... ||.|.:||..:.. |.:||.:|:.|.|
Human   495 NPTYNEALVFDVAPESVENVGLSIAVVDYDCIGHNEV-IGVCRVGPDAADPHGREHWAEMLANPR 558

  Fly   593 KPTAMWHYI 601
            ||...||.:
Human   559 KPVEHWHQL 567

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SytbetaNP_648734.1 C2 341..463 CDD:301316 42/124 (34%)
C2B_Synaptotagmin 473..601 CDD:175975 58/136 (43%)
SYT3NP_001153800.1 Cysteine motif. /evidence=ECO:0000250|UniProtKB:O35681 10..34
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 143..220 18/77 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 234..260 6/26 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 273..295 7/39 (18%)
C2A_Synaptotagmin-1-5-6-9-10 299..424 CDD:176031 43/152 (28%)
C2B_Synaptotagmin-3-5-6-9-10 433..567 CDD:176048 58/136 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925064at2759
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.