DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sytbeta and SYTD

DIOPT Version :9

Sequence 1:NP_648734.1 Gene:Sytbeta / 39630 FlyBaseID:FBgn0261090 Length:602 Species:Drosophila melanogaster
Sequence 2:NP_196671.2 Gene:SYTD / 830978 AraportID:AT5G11100 Length:569 Species:Arabidopsis thaliana


Alignment Length:257 Identity:60/257 - (23%)
Similarity:111/257 - (43%) Gaps:66/257 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   357 LTVHLIEAHNLSPIEEGGFRDPYVRLMLQPEVDSRKRQTHIHRGESNPYFDQHFKFPVSRDQLQG 421
            |.|.:::|.:|:..:..|..|||..:.::|..| |.::|.......||.:::||:|.|  :.:..
plant   266 LDVKVVQAKDLANKDMIGKSDPYAIVFIRPLPD-RTKKTKTISNSLNPIWNEHFEFIV--EDVST 327

  Fly   422 KELILQVLDYDRYSHNDIIGEVRISVDGLDLSKSVEIWGDLLR-------TKKPKEDRPELL-C- 477
            :.|.::|.|.:....:.:||..::.::.|...|..:||..|::       ||...:.:.||| | 
plant   328 QHLTVRVFDDEGVGSSQLIGAAQVPLNELVPGKVKDIWLKL
VKDLEIQRDTKNRGQVQLELLYCP 392

  Fly   478 ---------------SLNYL-----PQAER----------------------LTVVIMKARNLDT 500
                           ||..|     |::|.                      |:|.::.|.:|..
plant   393 LGKEGGLKNPFNPDYSLTILEKVLKPESEDSDATDMKKLVTSKKKDVIVRGVLSVTVVAAEDLPA 457

  Fly   501 LQ-----EPYVKIYLIQNGKRIKKKKTSITKSDDPTNPIWNEAFTFNLQSNYLHN-AAIEIY 556
            :.     :.:|.|.|   .|...|.||.:.  .|..||:||:.|.|.:: :.||: ..:|::
plant   458 VDFMGKADAFVVITL---KKSETKSKTRVV--PDSLNPVWNQTFDFVVE-DALHDLLTLEVW 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SytbetaNP_648734.1 C2 341..463 CDD:301316 27/105 (26%)
C2B_Synaptotagmin 473..601 CDD:175975 30/134 (22%)
SYTDNP_196671.2 SMP_LBD 69..251 CDD:293652
C2 264..368 CDD:278593 27/104 (26%)
C2 443..545 CDD:278593 21/77 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.