DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sytbeta and pla2g4f.1

DIOPT Version :9

Sequence 1:NP_648734.1 Gene:Sytbeta / 39630 FlyBaseID:FBgn0261090 Length:602 Species:Drosophila melanogaster
Sequence 2:XP_021323073.1 Gene:pla2g4f.1 / 798864 ZFINID:ZDB-GENE-131121-408 Length:866 Species:Danio rerio


Alignment Length:234 Identity:51/234 - (21%)
Similarity:87/234 - (37%) Gaps:58/234 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   343 RLHLRVKYDYHLFDLTVHLIEAHNLSPIEEGGFRDPYVRLMLQPEVDSRKRQTHIHRGESNPYFD 407
            |..:...|||                 :.|.   |.||.|.| |...:|.::|......:||.::
Zfish    47 RAKIHQSYDY-----------------LNES---DCYVILNL-PTASARTKRTKTIPSNNNPEWN 90

  Fly   408 QHFKFPVSRDQLQGKELILQVLDYDR--YSHNDIIGEVRISVDGLDLSKSV------------EI 458
            :.|.|.|    ....:.:|:::.||.  :..:|..|.:...|:.|...|..            |:
Zfish    91 ETFTFRV----FSNIKNVLEIMVYDEDPFMRDDQCGTILFDVNNLTPGKKETKCFIINEKTKNEL 151

  Fly   459 WGDLLRTKKPKEDRPELLCSLNYL----PQAERLTVVIMK-ARNLDTLQEPYVKIYLIQNGKRIK 518
            |.:...||.....||   |:.|.:    |..| |.|.|.| .:|.:.:|...:|:      |...
Zfish   152 WVEFEMTK
SSVTPRP---CTSNGVLVAGPFCE-LNVEIDKLLKNSEAIQNMVLKL------KGAY 206

  Fly   519 KKKTSITKSDDPTNPIWNEAFTFN----LQSNYLHNAAI 553
            |:...|:..|:.::.:....:..|    .:.|....||:
Zfish   207 KEDIVISNLDESSSIMTTLRYFINRDLETELNLTSEAAV 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SytbetaNP_648734.1 C2 341..463 CDD:301316 28/133 (21%)
C2B_Synaptotagmin 473..601 CDD:175975 20/90 (22%)
pla2g4f.1XP_021323073.1 C2_cPLA2 40..159 CDD:176001 28/136 (21%)
cPLA2_Grp-IVB-IVD-IVE-IVF 295..835 CDD:132840
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.