DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sytbeta and syt11b

DIOPT Version :9

Sequence 1:NP_648734.1 Gene:Sytbeta / 39630 FlyBaseID:FBgn0261090 Length:602 Species:Drosophila melanogaster
Sequence 2:NP_001156003.1 Gene:syt11b / 794707 ZFINID:ZDB-GENE-090601-7 Length:456 Species:Danio rerio


Alignment Length:277 Identity:88/277 - (31%)
Similarity:140/277 - (50%) Gaps:15/277 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   335 PESSHAVGRLHLRVKYDYHLFDLTVHLIEAHNLSPIE-EGGFRDPYVRLMLQPEVDSRKRQTHIH 398
            |....:.|.|.:.:.|::....|.|.::||..|..:| :.|..||||::.:.||...|.: |.:.
Zfish   180 PADEPSRGDLSIAIDYNFPKKALVVTILEARGLPAVEGQTGSADPYVKMTILPEKKHRVK-TRVL 243

  Fly   399 RGESNPYFDQHFKF-PVSRDQLQGKELILQVLDYDRYSHNDIIGEVRISVDGLDLSKS-VEIWGD 461
            |....|.||:.|.| .|....|....|...||.:||:|.:|:|||..:.:.|:|.|.. |.|...
Zfish   244 RKTLEPAFDETFTFYGVPYSSLSDLTLHFLVLSFDRFSRDDVIGEAMVPLAGVDPSTGRVHITQQ 308

  Fly   462 LLRTKKPKEDRPELLCSLNYLPQAERLTVVIMKARNLDTLQ------EPYVKIYLIQNGKRIKKK 520
            :.:.........|||.||:|.|.:.||:||::||::|..|.      .||||:.:....|||.||
Zfish   309 ITKRNMQCVSHGELLVSLSYQPVSHRLSVVVLKAKHLPKLDITGLSANPYVKLNVFYGHKRIAKK 373

  Fly   521 KTSITKSDDPTNPIWNEAFTFNLQSNYLHNAAIEIYVV--GAGSEATEIGCCGLGPQE-SGTGCQ 582
            ||.:.|.  ..||::||:|.:::.:..|.:.:||..|:  ...::...:|...||... ..:|..
Zfish   374 KTHVKKC--TLNPVFNESFIYDVPAELLPDISIEFLVMDFDRTTKNQALGRLVLGADSPCPSGAA 436

  Fly   583 HWHDMINNARKPTAMWH 599
            ||.::..|.|:..:.||
Zfish   437 HWQEVCQNPRRQISKWH 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SytbetaNP_648734.1 C2 341..463 CDD:301316 41/124 (33%)
C2B_Synaptotagmin 473..601 CDD:175975 46/136 (34%)
syt11bNP_001156003.1 C2 186..309 CDD:301316 41/123 (33%)
C2B_Synaptotagmin-4 320..456 CDD:176049 46/136 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925064at2759
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.