DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sytbeta and Pla2g4d

DIOPT Version :9

Sequence 1:NP_648734.1 Gene:Sytbeta / 39630 FlyBaseID:FBgn0261090 Length:602 Species:Drosophila melanogaster
Sequence 2:NP_001019308.1 Gene:Pla2g4d / 78390 MGIID:1925640 Length:825 Species:Mus musculus


Alignment Length:233 Identity:60/233 - (25%)
Similarity:97/233 - (41%) Gaps:37/233 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   357 LTVHLIEAHNLSPIEEGGFRDPYVRLMLQPEVDSRKRQTHIHRGESNPYFDQHFKFPVSRDQLQG 421
            |||.::||.:|...:.....||||.:.| |.....|.:|......|:|.:::.|.|.:   |.|.
Mouse    33 LTVKILEARSLPRADLLSQADPYVTVQL-PTASGMKFKTQTVTNSSHPVWNETFSFLI---QSQV 93

  Fly   422 KELI-LQVLDYDRYSHNDIIGEVRISVD----GLDLSKSVEIWGDLLRTKKPKEDRPELLCSLNY 481
            |.:: |.:.|.|..:.:||..:|...|.    |..|.|:..     |..:.|:|...|||....:
Mouse    94 KNILELTIYDEDVITKDDICFKVSYDVSEILPGQLLQKTFS-----LNPQGPEELDVELLMER
TW 153

  Fly   482 LPQAERLTVVIMKARNLDTLQEPYVKIYLIQN-----GKRIKKKKTSITKSDDPTNPIW-NEAFT 540
            .|....:|..::.||.|..|.   |.:....|     |:...:.:..:..|.:.|...: :.|||
Mouse   154 DPPENLITNNVLVARELSHLD---VSLDRAGNTAMAAGQDKLELELMLKGSYEDTQTFFPDTAFT 215

  Fly   541 FNLQSNYLHNAAIEIYVVGAGSEATEIGCCGLGPQESG 578
            |:..           |:.|   :.||:.....||:.||
Mouse   216 FSFH-----------YMRG---QDTELNGYLRGPRNSG 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SytbetaNP_648734.1 C2 341..463 CDD:301316 31/110 (28%)
C2B_Synaptotagmin 473..601 CDD:175975 26/112 (23%)
Pla2g4dNP_001019308.1 C2_cPLA2 32..151 CDD:176001 37/126 (29%)
Patatin_and_cPLA2 278..814 CDD:299702
PLAc 283..758 CDD:214474
Substrate binding. /evidence=ECO:0000250|UniProtKB:Q86XP0 339..340
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.