DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sytbeta and SYT5

DIOPT Version :9

Sequence 1:NP_648734.1 Gene:Sytbeta / 39630 FlyBaseID:FBgn0261090 Length:602 Species:Drosophila melanogaster
Sequence 2:NP_003171.2 Gene:SYT5 / 6861 HGNCID:11513 Length:386 Species:Homo sapiens


Alignment Length:306 Identity:115/306 - (37%)
Similarity:182/306 - (59%) Gaps:26/306 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   313 SPLGALQPDLYRM---PDGPVYLTAPESSHAVGRLHLRVKYDYHLFDLTVHLIEAHNLSPIEEGG 374
            |.:..:||::..:   |.||....|  ..|.:|||...:.||:....|.|.:::|..|:.::.||
Human    80 SYIDKVQPEVEELEPAPSGPGQQVA--DKHELGRLQYSLDYDFQSGQLLVGILQAMGLAALDLGG 142

  Fly   375 FRDPYVRLMLQPEVDSRKR-QTHIHRGESNPYFDQHFKFPVSRDQLQGKELILQVLDYDRYSHND 438
            ..|||||:.|.|  |.|:| :|.:||...||:|.:.|.|.|...:|.|:.|::.|.|:||:|.||
Human   143 SSDPYVRVYLLP--DKRRRYETKVHRQTLNPHFGETFAFKVPYVELGGRVLVMAVYDFDRFSRND 205

  Fly   439 IIGEVRISVDGLDLSKSVEIWGDLLRTKKPKEDRPEL--LC-SLNYLPQAERLTVVIMKARNLDT 500
            .|||||:.:..:||.:.|:.|.:|  ...|:|::.:|  :| ||.|:|.|.:|||::::|:||..
Human   206 AIGEVRVPMSSVDLGRPVQAWREL--QAAPREEQEKLGDICFSLRYVPTAGKLTVIVLEAKNLKK 268

  Fly   501 -----LQEPYVKIYLIQNGKRIKKKKTSITKSDDPTNPIWNEAFTFNLQSNYLHNAAIEIYVVG- 559
                 |.:||||::|:|.||:::||||:|.|  :..||.:||||:|.:..:.:....:|:.|:. 
Human   269 MDVGGLSDPYVKVHLLQGGKKVRKKKTTIKK--NTLNPYYNEAFSFEVPCDQVQKVQVELTVLDY 331

  Fly   560 ---AGSEATEIGCCGLGPQESGTGCQHWHDMINNARKPTAMWHYIR 602
               ..:||  ||...:|....|.|.:||.||:.|.|:|.|.||.:|
Human   332 DKLGKNEA--IGRVAVGAAAGGAGLRHWADMLANPRRPIAQWHSLR 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SytbetaNP_648734.1 C2 341..463 CDD:301316 49/122 (40%)
C2B_Synaptotagmin 473..601 CDD:175975 54/139 (39%)
SYT5NP_003171.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
C2A_Synaptotagmin-1-5-6-9-10 109..231 CDD:176031 50/125 (40%)
C2 240..374 CDD:387358 54/137 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925064at2759
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.