DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sytbeta and Syt11

DIOPT Version :9

Sequence 1:NP_648734.1 Gene:Sytbeta / 39630 FlyBaseID:FBgn0261090 Length:602 Species:Drosophila melanogaster
Sequence 2:XP_006232810.1 Gene:Syt11 / 60568 RGDID:62042 Length:430 Species:Rattus norvegicus


Alignment Length:375 Identity:120/375 - (32%)
Similarity:186/375 - (49%) Gaps:62/375 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 LDARCGSPAHSADPGDLRTPSPSQSSLASLAGGSGMGGSSAGKGVAGGRCLSPLLIPPRSQPGVD 306
            ::|..|..:|..||   |.|||:.                         |:..|  |.:...|.:
  Rat    96 VNAESGLLSHDRDP---RGPSPAS-------------------------CIDQL--PIKRDYGEE 130

  Fly   307 PAMGPASPLGALQPDLYRMPDGPVYLTAPESSHAVGRLHLRVKYDYHLFDLTVHLIEAHNLSPIE 371
                ..||:.:|.|...: |..|   ::||....:|.|...|.|::....|.|.:.|||.| |:.
  Rat   131 ----LRSPMTSLTPGESK-PTSP---SSPEEDVMLGSLTFSVDYNFPKKALVVTIQEAHGL-PVM 186

  Fly   372 EGGFR--DPYVRLMLQPEVDSRKR-QTHIHRGESNPYFDQHFKF---PVSRDQLQGKELILQVLD 430
            :|..:  |||:::.:.|  |.|.| :|.:.|...:|.||:.|.|   |.|  |||...|...||.
  Rat   187 DGQTQGSDPYIKMTILP--DKRHRVKTRVLRKTLDPVFDETFTFYGIPYS--QLQDLVLHFLVLS 247

  Fly   431 YDRYSHNDIIGEVRISVDGLDLSK-SVEIWGDLLRTKKPK-EDRPELLCSLNYLPQAERLTVVIM 493
            :||:|.:|:||||.:.:.|:|.|. .|::..|:::....| ..|.||..||:|.|.|:|:|||::
  Rat   248 FDRFSRDDVIGEVMVPLAGVDPSTGKVQLTRDIIKRNIQKCISRGELQVSLSYQPVAQRMTVVVL 312

  Fly   494 KARNLDTLQ------EPYVKIYLIQNGKRIKKKKTSITKSDDPTNPIWNEAFTFNLQSNYLHNAA 552
            |||:|..:.      .||||:.:....|||.||||.:.|.  ..|||:||:|.:::.::.|.:.:
  Rat   313 KARHLPKMDITGLSGNPYVKVNVYYGRKRIAKKKTHVKKC--TLNPIFNESFIYDIPTDLLPDIS 375

  Fly   553 IEIYVV--GAGSEATEIGCCGLGPQESGT-GCQHWHDMINNARKPTAMWH 599
            ||..|:  ...::...:|...||.....| |.:||.::..:.|||.|.||
  Rat   376 IEFLVIDFDRTTKNEVVGRLILGAHSVTTSGAEHWREVCESPRKPVAKWH 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SytbetaNP_648734.1 C2 341..463 CDD:301316 47/128 (37%)
C2B_Synaptotagmin 473..601 CDD:175975 50/136 (37%)
Syt11XP_006232810.1 C2A_Synaptotagmin-4-11 157..282 CDD:176034 47/129 (36%)
C2B_Synaptotagmin-4 291..428 CDD:176049 51/137 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925064at2759
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.