DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sytbeta and Syt9

DIOPT Version :9

Sequence 1:NP_648734.1 Gene:Sytbeta / 39630 FlyBaseID:FBgn0261090 Length:602 Species:Drosophila melanogaster
Sequence 2:NP_068689.2 Gene:Syt9 / 60510 MGIID:1926373 Length:491 Species:Mus musculus


Alignment Length:302 Identity:108/302 - (35%)
Similarity:162/302 - (53%) Gaps:28/302 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   315 LGALQPDLYRM-----PDGPVYLTAPESSHAVGRLHLRVKYDYHLFDLTVHLIEAHNLSPIEEGG 374
            :|.::|:||:.     .||     ...:|.|.|:|:..:|||..|..|.|.:.:|.||...:..|
Mouse   195 IGRIKPELYKQRSLDNDDG-----RRSNSKACGKLNFILKYDCDLEQLIVKIHKAVNLPAKDFSG 254

  Fly   375 FRDPYVRLMLQPEVDSRKRQTHIHRGESNPYFDQHFKFPVSRDQLQGKELILQVLDYDRYSHNDI 439
            ..||||::.|.|: ...|.||.:||...||.||:.|.|||..:.|:.::|...|.|:||:|.:|:
Mouse   255 TSDPYVKIYLLPD-RKTKHQTKVHRKTLNPVFDEVFLFPVHYNDLEARKLHFSVYDFDRFSRHDL 318

  Fly   440 IGEVRIS--VDGLDLSKSVEIWGDLLRTKKPKEDRPELLCSLNYLPQAERLTVVIMKARNLDTL- 501
            ||:|.:.  .|..|..:...:|.|:........|..||:.||.|||.|.|||:.|:|||||..: 
Mouse   319 IGQVVVDHFFDLADFPRECILWKDIEYVTNDNVDLGELMFSLCYLPTAGRLTITIIKARNLKAMD 383

  Fly   502 ----QEPYVKIYLIQNGKRIKKKKTSITKSDDPTNPIWNEAFTFNLQSNYLHNAAIEIYV----- 557
                .:||||:.|:.:|:|:||:|||..:  :..||::|||..|::....:....:.|.|     
Mouse   384 ITGASDPYVKVSLMCDGRRLKKRKTSTKR--NTLNPVYNEAIVFDVPPESIDQIHLSIAVMDYDR 446

  Fly   558 VGAGSEATEIGCCGLGPQESGTGCQHWHDMINNARKPTAMWH 599
            ||...   .||.|.:|.:....|..||.:|::..|||.|.||
Mouse   447 VGHNE---VIGVCQVGNEAERLGRDHWSEMLSYPRKPIAHWH 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SytbetaNP_648734.1 C2 341..463 CDD:301316 46/123 (37%)
C2B_Synaptotagmin 473..601 CDD:175975 53/137 (39%)
Syt9NP_068689.2 Cysteine motif. /evidence=ECO:0000250|UniProtKB:O35681 9..31
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..147
C2 221..345 CDD:387358 46/124 (37%)
C2B_Synaptotagmin-3-5-6-9-10 354..487 CDD:176048 53/137 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925064at2759
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.