DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sytbeta and syt5b

DIOPT Version :9

Sequence 1:NP_648734.1 Gene:Sytbeta / 39630 FlyBaseID:FBgn0261090 Length:602 Species:Drosophila melanogaster
Sequence 2:NP_001018382.2 Gene:syt5b / 553567 ZFINID:ZDB-GENE-050522-134 Length:446 Species:Danio rerio


Alignment Length:275 Identity:98/275 - (35%)
Similarity:161/275 - (58%) Gaps:12/275 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   336 ESSHAVGRLHLRVKYDYHLFDLTVHLIEAHNLSPIEEGGFRDPYVRLMLQPEVDSRKRQTHIHRG 400
            |....:|:|...:.|::....|.|.:::|.:|:.::.||..||||::.|.|: ..:|.:|.:.|.
Zfish   162 EEHENLGKLEFSLDYNFTDAQLIVGILQAQDLAAMDIGGTSDPYVKVYLLPD-KKKKFETKVQRK 225

  Fly   401 ESNPYFDQHFKFPVSRDQLQGKELILQVLDYDRYSHNDIIGEVRISVDGLDLSKSVEIWGDLLRT 465
            ...|.|::.|.|.:...:|.||.|:|||.|:||:..:|:||:::|.::.:||::.:..|.:|...
Zfish   226 NLCPVFNETFIFKIPYAELGGKTLVLQVFDFDRFGKHDVIGQIKIPMNCVDLAQPLHEWRELENG 290

  Fly   466 KKPKEDRPELLCSLNYLPQAERLTVVIMKARNLDT-----LQEPYVKIYLIQNGKRIKKKKTSIT 525
            :|.:|...::..||.|:|.|.:|||.||:|:||..     |.:|||||.|..||||:|||||::.
Zfish   291 EKEEEKLGDVCISLRYVPTAGKLTVNIMEAKNLKKMDVGGLSDPYVKIVLQHNGKRLKKKKTTVK 355

  Fly   526 KSDDPTNPIWNEAFTFNLQSNYLHNAAIEIYVVG---AGSEATEIGCCGLGPQESGTGCQHWHDM 587
            |  :..||.:||:|:|.:....:....:.|.|..   .||. ..||...:|...:|.|.:||.||
Zfish   356 K--NTLNPYFNESFSFEVPFEQIQKVQLLITVYDYDKLGSN-DPIGKTFIGYGATGVGLRHWSDM 417

  Fly   588 INNARKPTAMWHYIR 602
            :.|.|:|.|.||.::
Zfish   418 LANPRRPVAQWHTLQ 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SytbetaNP_648734.1 C2 341..463 CDD:301316 39/121 (32%)
C2B_Synaptotagmin 473..601 CDD:175975 55/135 (41%)
syt5bNP_001018382.2 C2A_Synaptotagmin-1-5-6-9-10 166..285 CDD:176031 38/119 (32%)
C2B_Synaptotagmin-1 298..432 CDD:176047 55/136 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925064at2759
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.