DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sytbeta and syt1a

DIOPT Version :9

Sequence 1:NP_648734.1 Gene:Sytbeta / 39630 FlyBaseID:FBgn0261090 Length:602 Species:Drosophila melanogaster
Sequence 2:NP_001314758.1 Gene:syt1a / 436736 ZFINID:ZDB-GENE-040718-165 Length:419 Species:Danio rerio


Alignment Length:279 Identity:103/279 - (36%)
Similarity:165/279 - (59%) Gaps:17/279 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   335 PESSHAVGRLHLRVKYDYHLFDLTVHLIEAHNLSPIEEGGFRDPYVRLMLQPEVDSRKRQTHIHR 399
            |:....:|:|...:.|::....|.|.:|:|..|..::.||..||||::.|.|: ..:|.:|.:||
Zfish   133 PKEEEKLGKLQYSMDYNFTENTLIVGIIQAAELPAMDMGGTSDPYVKVYLLPD-KKKKFETKVHR 196

  Fly   400 GESNPYFDQHFKFPVSRDQLQGKELILQVLDYDRYSHNDIIGEVRISVDGLDLSKSVEIWGDLLR 464
            ...||.|::.|.|.|...:|.||.|::.|.|:||:|.:|.||:|::.::.:|.|...|.|.||..
Zfish   197 KTLNPVFNEQFTFKVPYTELGGKTLVMTVYDFDRFSKHDAIGDVKVPMNKVDFSHVTEEWRDLQS 261

  Fly   465 TKKPKEDRPELLC-SLNYLPQAERLTVVIMKARNLDT-----LQEPYVKIYLIQNGKRIKKKKTS 523
            .:|.::::...:| ||.|:|.|.:||||:::|:||..     |.:|||||:|:|||||:|||||:
Zfish   262 AEKEEQEKLGDICFSLRYVPTAGKLTVVVLEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTT 326

  Fly   524 ITKSDDPTNPIWNEAFTFNLQSNYLHNAAIEIYV-----VGAGSEATEIGCCGLGPQESGTGCQH 583
            |.|  :..||.:||:|:|.:....:....:.|.|     :|...   .||...:|...:||..:|
Zfish   327 IKK--NTLNPYYNESFSFEVPFEQIQKVQVVITVLDYDKIGKND---AIGKVFVGLNSTGTELRH 386

  Fly   584 WHDMINNARKPTAMWHYIR 602
            |.||:.|.|:|.|.||.::
Zfish   387 WSDMLANPRRPIAQWHVLK 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SytbetaNP_648734.1 C2 341..463 CDD:301316 44/121 (36%)
C2B_Synaptotagmin 473..601 CDD:175975 56/138 (41%)
syt1aNP_001314758.1 C2A_Synaptotagmin-1-5-6-9-10 139..261 CDD:176031 45/122 (37%)
C2B_Synaptotagmin-1 270..405 CDD:176047 56/139 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925064at2759
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.