DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sytbeta and syt5a

DIOPT Version :9

Sequence 1:NP_648734.1 Gene:Sytbeta / 39630 FlyBaseID:FBgn0261090 Length:602 Species:Drosophila melanogaster
Sequence 2:NP_001096607.1 Gene:syt5a / 436686 ZFINID:ZDB-GENE-040718-110 Length:405 Species:Danio rerio


Alignment Length:270 Identity:96/270 - (35%)
Similarity:160/270 - (59%) Gaps:13/270 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   342 GRLHLRVKYDYHLFDLTVHLIEAHNLSPIEEGGFRDPYVRLMLQPEVDSRKRQTHIHRGESNPYF 406
            |:|...:.|::....|.|.:::|.:|..::.||..||||::.:.|: ..:|.:|.:.|....|.|
Zfish   126 GKLEYTLDYNFTENQLIVGILQAQDLPAMDIGGTSDPYVKVYMLPD-KKKKFETKVQRKNLCPVF 189

  Fly   407 DQHFKFPVSRDQLQGKELILQVLDYDRYSHNDIIGEVRISVDGLDLSKSVEIWGDLLRTKKPKED 471
            ::.|.|.:..:.|.|:.|:|||.|:||:..:|:|||::|.::.:||.:.:..:.||:..:|.:::
Zfish   190 NETFIFKIPFNDLAGQTLVLQVFDFDRFGKHDVIGEIKIPMNSIDLGQPIHEYKDLVGGEKEEQE 254

  Fly   472 RPELLC-SLNYLPQAERLTVVIMKARNLDT-----LQEPYVKIYLIQNGKRIKKKKTSITKSDDP 530
            :...:| ||.|:|.:.:|||.||:|:||..     |.:|:|||.|..||||||||||::  ..:.
Zfish   255 KLGDICISLRYVPTSGKLTVCIMEAKNLKKMDVGGLSDPFVKIVLQHNGKRIKKKKTTV--KQNT 317

  Fly   531 TNPIWNEAFTFNLQSNYLHNAAIEIYVVG---AGSEATEIGCCGLGPQESGTGCQHWHDMINNAR 592
            .||.:||:|:|.:....:....:.|.|..   .||. ..||.|.:|...||.|.:||.||:.|.|
Zfish   318 LNPYFNESFSFEIPFAQIQKVQVLITVYDYDKLGSN-DPIGKCWIGFGASGVGLRHWSDMLANPR 381

  Fly   593 KPTAMWHYIR 602
            :|.|.||.::
Zfish   382 RPVAQWHTLQ 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SytbetaNP_648734.1 C2 341..463 CDD:301316 38/120 (32%)
C2B_Synaptotagmin 473..601 CDD:175975 56/136 (41%)
syt5aNP_001096607.1 C2A_Synaptotagmin-1-5-6-9-10 128..246 CDD:176031 37/118 (31%)
C2B_Synaptotagmin-1 256..391 CDD:176047 56/137 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925064at2759
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.