DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sytbeta and Syt14

DIOPT Version :9

Sequence 1:NP_648734.1 Gene:Sytbeta / 39630 FlyBaseID:FBgn0261090 Length:602 Species:Drosophila melanogaster
Sequence 2:NP_001262249.1 Gene:Syt14 / 40544 FlyBaseID:FBgn0261086 Length:648 Species:Drosophila melanogaster


Alignment Length:638 Identity:131/638 - (20%)
Similarity:221/638 - (34%) Gaps:180/638 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VGAVRRVTLDRNSADEGTPSGS--------------GASSTAGGNGVSVVHILPIGEGSTTPPPQ 77
            |..|:::|  |....|.|.|.|              ......||.|:.:....|:          
  Fly    63 VKCVQKIT--RKRRYENTSSDSEEDILRRLRWHQQHQLGEKPGGYGLGISQANPL---------- 115

  Fly    78 PMTPPPSASSVTSTTSGIGSVSAGSVSDSCDLPTDSEEVAIAKECQPIQPASQLHGMHGGMGLN- 141
                         |........||:.:|...:....:.:|||:..:...|:|     |.....| 
  Fly   116 -------------TAQSFNYHQAGASADLQRVTVSRDPLAIAERGKVGIPSS-----HSECSSND 162

  Fly   142 ------HHHMGTVS--ATGTDILRGPAEVFHSPLHLHHQSRSFPPRLQRTPSISSQSSVD-SAPS 197
                  ..|.|.::  :..|..:..||..|.:|...|.         .:|.::..|..|: :||.
  Fly   163 SMEVSVDSHTGVLTGLSKATTTVPHPATAFRNPCGEHR---------AKTQALRYQHRVNVAAPP 218

  Fly   198 RHSGHRGS---SPQIRTFG-PDGRSSLPSEPGFPHHLARSPSPMRTISLDARCGSPAHSADPGDL 258
            :....|.:   .|.:..:. .:..:|:.:....|........|:               .|..||
  Fly   219 KLDKERDNVLVVPMVNAYSINNNNNSITTSNNHPSSNNNDDEPL---------------FDTSDL 268

  Fly   259 RTPSPSQSSLASLAGGSGMGGSSAGKGVAGGRCLSPLLIPPRSQPGVDPAMGPASPLGALQPDLY 323
            |       |:.|                      ..||:      |||..          :|.:.
  Fly   269 R-------SIKS----------------------DDLLV------GVDQK----------EPAVQ 288

  Fly   324 RMPDGPVYLTAPESSHAVGRLHLRVKYDYHLFDLTVHLIEAHNLSPIEEGGFRDPYVRLMLQPEV 388
            |   ||:            .|.|.:.||..:..:|||:::|.||.|:..|......||:::.|. 
  Fly   289 R---GPI------------ELELSLLYDAPMRKMTVHVMQAKNLPPLGSGQTTHTQVRMLMLPS- 337

  Fly   389 DSRKRQTHIHRGESNPYFDQHFKFPVSRDQLQGKELILQVLDYDRYSHNDIIGEVRISVDGLDLS 453
            ..:|.:|.|..||:..|.:......|:.:.:....|.:::...:|.....:|||..:|...:||.
  Fly   338 KKQKLKTKIRSGENPQYMESFLLHRVNPEDVNNMGLRVRLYGCERLRKERLIGEAYVSFATVDLE 402

  Fly   454 KSVEIW---------------GDLLRTKKPKE----------DRPELLCSLNYLPQAERLTVVIM 493
            ....:|               .|||...:.:.          ...|||..|:|.....||:|.|:
  Fly   403 LETNLWLPLEPRNTSSGLGSTSDLLSLARSESAGSTSSMQHGGVSELLLGLSYNGVTGRLSVEII 467

  Fly   494 KA---RNLDTLQEP--YVKIYLIQN-GKRIKKKKTSITKSDDPTNPIWNEAFTFNLQSNYLHNAA 552
            |.   |:|...:.|  |||:.::.: |:.|.:.||||.:..  .||::.|.|.|.:....|::..
  Fly   468 KGSQFRSLSLNKAPDTYVKMVMVSSIGQEISRAKTSIRRGQ--PNPLFKETFAFQVALFQLNDVT 530

  Fly   553 --IEIYVVGAGSEATEIGCCGLGPQESGT-GCQHWHDMINNAR-KPTAMWHYI 601
              |.:|......:...:|...||...||: ...||.|:....: :..|.||.:
  Fly   531 LMISVYAKRHMKKNEMVGWFSLGLNSSGSEEVAHWADVCEMPKGEMLARWHVL 583

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SytbetaNP_648734.1 C2 341..463 CDD:301316 32/136 (24%)
C2B_Synaptotagmin 473..601 CDD:175975 41/137 (30%)
Syt14NP_001262249.1 C2A_Synaptotagmin-14_16 291..413 CDD:176035 32/134 (24%)
C2B_Synaptotagmin-14_16 446..584 CDD:176053 41/140 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468167
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.