DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sytbeta and Pla2g4e

DIOPT Version :9

Sequence 1:NP_648734.1 Gene:Sytbeta / 39630 FlyBaseID:FBgn0261090 Length:602 Species:Drosophila melanogaster
Sequence 2:XP_017447688.1 Gene:Pla2g4e / 296091 RGDID:1310595 Length:900 Species:Rattus norvegicus


Alignment Length:167 Identity:41/167 - (24%)
Similarity:71/167 - (42%) Gaps:26/167 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   386 PEVDSRKRQTHIHRGESNPYFDQHFKFPVSRDQLQGKELILQVLDYDRYSHNDIIG--EVRISVD 448
            |.|||.|.:.......|..  |....||:....:..:.  .|||..:|:.:.....  .:.:|..
  Rat    19 PSVDSGKPELESRHDASEA--DACLGFPLPVRHMPSRR--WQVLGAERHGNERAAACLTLEMSTI 79

  Fly   449 GLDLSKSVEIWGDLLRTKKPKEDRPELLCSLNYLPQAERLTVVIMKARNL---DTLQEP--YVKI 508
            |.:.|::.:....:....:.:...|   |.|        |||.|:..:|:   |.|.:.  :|.:
  Rat    80 GEETSQNKQCQKSMWAAARQEGSSP---CHL--------LTVRIISMKNVRQADILSQTDCFVTL 133

  Fly   509 YLIQNGKRIKKKKTSITKSDDPTNPIWNEAFTFNLQS 545
            :|   ....:||..:.|.|:.| :|.|||:|||.:|:
  Rat   134 WL---PTASQKKLRTRTISNCP-HPEWNESFTFQIQT 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SytbetaNP_648734.1 C2 341..463 CDD:301316 16/78 (21%)
C2B_Synaptotagmin 473..601 CDD:175975 25/78 (32%)
Pla2g4eXP_017447688.1 C2_cPLA2 107..215 CDD:176001 23/72 (32%)
cPLA2_C2 247..354 CDD:408472
Patatin_and_cPLA2 353..895 CDD:416256
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.