DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sytbeta and Doc2g

DIOPT Version :9

Sequence 1:NP_648734.1 Gene:Sytbeta / 39630 FlyBaseID:FBgn0261090 Length:602 Species:Drosophila melanogaster
Sequence 2:XP_006230797.1 Gene:Doc2g / 293654 RGDID:1307473 Length:389 Species:Rattus norvegicus


Alignment Length:384 Identity:88/384 - (22%)
Similarity:154/384 - (40%) Gaps:79/384 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 GRCLSPLLIPPRSQPGVDPAMGPASPLGALQ---PDLY-------RMPD-----GPVYLTAP--- 335
            ||......:..:....:|.:.||..|:..:.   |..|       |:||     .|...:||   
  Rat     5 GRASGRQRVSMQEHMAIDVSPGPIQPIRLISDYFPHFYPFLEPVLRVPDRQAMLAPAIHSAPQLQ 69

  Fly   336 ---------ESSHAVGRLHLRVKYDYHLFDL---TVHLI--EAHNLSPIEEGGFRDPYVRLMLQP 386
                     :.|.|:|.|...:     |||:   |:|..  .|..|.|...|.. |.||:..|.|
  Rat    70 PNPEAEGDSDDSTALGTLEFTL-----LFDVDNSTLHCTAHRAKGLKPPATGSV-DTYVKANLLP 128

  Fly   387 ---EVDSRKRQTHIHRGESNPYFDQHFKFPVSRDQLQG-KELILQVLDYDRYSHN---DIIGEVR 444
               :|.:.:.:|...||...|.:::...:.....|..| |.|.|.|.:..|....   ..:||:|
  Rat   129 GASKVRASQLRTRTVRGTREPVWEETLTYHGFTCQDAGRKTLRLCVCEDSRLRRRRRAPPLGELR 193

  Fly   445 ISVDGL--DLSKSVEIWGDLLR-TKKPK----------------------EDRPELLCSLNYLPQ 484
            :.:..|  :.::|.:|..:..| ||:||                      |:|..:|.||.|..:
  Rat   194 VPLRKLVPNRARSFDICLEKRRLTKRPKSLDTARGMSLYEEEEVEAEVFREERGRILLSLCYSSE 258

  Fly   485 AERLTVVIMKARNLDTL-----QEPYVKIYLIQNGKRIKKKKTSITKSDDPTNPIWNEAFTF-NL 543
            ...|.|.:::..:|..:     .:|:|:::|..:..:..|.|||:.:.  ..||.:||.|.: .|
  Rat   259 RGGLLVGVLRCAHLAPMDANGYSDPFVRLFLHPSSGKKSKYKTSVRRK--TLNPEFNEEFFYAGL 321

  Fly   544 QSNYLHNA-AIEIYVVGAGSEATEIGCCGLGPQESGTGCQHWHDMINNARKPTAMWHYI 601
            :......| .:.::....|:....||...|..:.||...:||.:.:::..:...:||.:
  Rat   322 REELAQKALLVSVWDYDLGTADDFIGGVQLSGRSSGDRLRHWCECLSHCDRRLELWHLL 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SytbetaNP_648734.1 C2 341..463 CDD:301316 34/135 (25%)
C2B_Synaptotagmin 473..601 CDD:175975 31/134 (23%)
Doc2gXP_006230797.1 C2A_Rabphilin_Doc2 84..211 CDD:176000 34/132 (26%)
C2 248..380 CDD:301316 31/133 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.