DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sytbeta and PLA2G4F

DIOPT Version :9

Sequence 1:NP_648734.1 Gene:Sytbeta / 39630 FlyBaseID:FBgn0261090 Length:602 Species:Drosophila melanogaster
Sequence 2:NP_998765.3 Gene:PLA2G4F / 255189 HGNCID:27396 Length:849 Species:Homo sapiens


Alignment Length:274 Identity:63/274 - (22%)
Similarity:107/274 - (39%) Gaps:62/274 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   328 GPVYLTAPESSHAVGRLHLRVKYDYHLFDLTVHLIEAHNLSPIEEGGFRDPYVRLMLQPEVDSRK 392
            |.|.|...|....:.|...|..|.|  :||.|.::.|.|:...:.....|.||:|.| |......
Human    19 GAVLLQKREKRGPLWRHWRRETYPY--YDLQVKVLRATNIRGTDLLSKADCYVQLWL-PTASPSP 80

  Fly   393 RQTHIHRGESNPYFDQHFKFPVSRDQLQGK-ELILQVLDYDRYSHNDIIGEVRISVDGLDLSKSV 456
            .||.|....|:|.:::.|.:     |:.|. :.:|::..||:    ||:|..::|:...||..  
Human    81 AQTRIVANCSDPEWNETFHY-----QIHGAVKNVLELTLYDK----DILGSDQLSLLLFDLRS-- 134

  Fly   457 EIWGDLLRTKKP------------KEDRPELLCSLNYLPQAERLTVVIMKA----RNLDTL---- 501
                  |:..:|            :|.:.|.:...:.:|.:|.:|..::.|    |...||    
Human   135 ------LKCGQPHKHTFPLNHQDSQELQVEFVLEKSQVPASEVITNGVLVAHPCLRIQGTLRGDG 193

  Fly   502 ---QEPYVKIYLIQNGKRIKK-------KKTSITKSDDPTNPIWNEAFTFNLQ---SNYLHNAAI 553
               :|.|        |.|..:       :|..:.....||.|.....|||::.   |:.||...:
Human   194 TAPREEY--------GSRQLQLAVPGAYEKPQLLPLQPPTEPGLPPTFTFHVNPVLSSRLHVELM 250

  Fly   554 EIYVVGAGSEATEI 567
            |:........:.|:
Human   251 ELLAAVQSGPSAEL 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SytbetaNP_648734.1 C2 341..463 CDD:301316 32/122 (26%)
C2B_Synaptotagmin 473..601 CDD:175975 24/116 (21%)
PLA2G4FNP_998765.3 C2_cPLA2 46..163 CDD:176001 31/134 (23%)
PLAc 295..791 CDD:214474
cPLA2_Grp-IVB-IVD-IVE-IVF 303..845 CDD:132840
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.