DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sytbeta and Syt11

DIOPT Version :9

Sequence 1:NP_648734.1 Gene:Sytbeta / 39630 FlyBaseID:FBgn0261090 Length:602 Species:Drosophila melanogaster
Sequence 2:NP_061274.2 Gene:Syt11 / 229521 MGIID:1859547 Length:430 Species:Mus musculus


Alignment Length:397 Identity:120/397 - (30%)
Similarity:182/397 - (45%) Gaps:86/397 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 RSPSPMRTISLDARCGSPAHSADPGDLRTPSPSQSSLASLAGGSGMGGSSAGKGVAGGRCLSPLL 296
            |..|....:.::|..|..:|..||   |.|||:.                         |:..|.
Mouse    86 RRESGRGNLLINAESGLLSHDKDP---RGPSPAS-------------------------CMDQLP 122

  Fly   297 I----------PPRS-QPGVDPAMGPASPLGALQPDLYRMPDGPVYLTAPESSHAVGRLHLRVKY 350
            |          |..| .||...|..|:|                     ||....:|.|...|.|
Mouse   123 IKRDYGEELRSPMTSLTPGESKATSPSS---------------------PEEDVMLGSLTFSVDY 166

  Fly   351 DYHLFDLTVHLIEAHNLSPIE---EGGFRDPYVRLMLQPEVDSRKR-QTHIHRGESNPYFDQHFK 411
            ::....|.|.:.|||.|..::   :|.  |||:::.:.|  |.|.| :|.:.|...:|.||:.|.
Mouse   167 NFPKKALVVTIQEAHGLPVMDDQTQGS--DPYIKMTILP--DKRHRVKTRVLRKTLDPVFDETFT 227

  Fly   412 F---PVSRDQLQGKELILQVLDYDRYSHNDIIGEVRISVDGLDLSK-SVEIWGDLLRTKKPK-ED 471
            |   |.|  |||...|...||.:||:|.:|:||||.:.:.|:|.|. .|::..|:::....| ..
Mouse   228 FYGIPYS--QLQDLVLHFLVLSFDRFSRDDVIGEVMVPLAGVDPSTGKVQLTRDIIKRNIQKCIS 290

  Fly   472 RPELLCSLNYLPQAERLTVVIMKARNLDTLQ------EPYVKIYLIQNGKRIKKKKTSITKSDDP 530
            |.||..||:|.|.|:|:|||::|||:|..:.      .||||:.:....|||.||||.:.|.  .
Mouse   291 RGELQVSLSYQPVAQRMTVVVLKARHLPKMDITGLSGNPYVKVNVYYGRKRIAKKKTHVKKC--T 353

  Fly   531 TNPIWNEAFTFNLQSNYLHNAAIEIYVV--GAGSEATEIGCCGLGPQESGT-GCQHWHDMINNAR 592
            .||::||:|.:::.::.|.:.:||..|:  ...::...:|...||.....| |.:||.::..:.|
Mouse   354 LNPVFNESFIYDIPTDLLPDISIEFLVIDFDRTTKNEVVGRLILGAHSVTTSGAEHWREVCESPR 418

  Fly   593 KPTAMWH 599
            ||.|.||
Mouse   419 KPIAKWH 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SytbetaNP_648734.1 C2 341..463 CDD:301316 46/129 (36%)
C2B_Synaptotagmin 473..601 CDD:175975 49/136 (36%)
Syt11NP_061274.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 79..120 12/61 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 132..152 7/40 (18%)
C2A_Synaptotagmin-4-11 157..282 CDD:176034 46/130 (35%)
C2B_Synaptotagmin-4 291..428 CDD:176049 50/137 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925064at2759
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.