DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sytbeta and Doc2a

DIOPT Version :9

Sequence 1:NP_648734.1 Gene:Sytbeta / 39630 FlyBaseID:FBgn0261090 Length:602 Species:Drosophila melanogaster
Sequence 2:NP_001355284.1 Gene:Doc2a / 13446 MGIID:109446 Length:405 Species:Mus musculus


Alignment Length:414 Identity:111/414 - (26%)
Similarity:174/414 - (42%) Gaps:83/414 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 HLARS--PSPMRTISLDARCGSPAHSADPGDLRTPSPSQSSLASLAGGSGMGGSSAGKGVAGGRC 291
            |:|.:  |.|:|.|         ...:|....|.|.|.        ||.|.||:..|:..|.   
Mouse    16 HMAINVCPGPIRPI---------RQISDYFPRRGPGPE--------GGGGGGGTGCGEAPAH--- 60

  Fly   292 LSPLLIPPRSQPGVDPAMGPASPLGALQPDLYRMPDG-PVYLTAPESSHAVGRLHLRVKYDYHLF 355
            |:||.:.|           ||:.|||..||     || .|.....:.:.|:|.|...:.||....
Mouse    61 LAPLALAP-----------PAALLGATTPD-----DGAEVDSYDSDDTTALGTLEFDLLYDQASC 109

  Fly   356 DLTVHLIEAHNLSPIEEGGFRDPYVRLMLQP-EVDSRKRQTHIHRGESNPYFDQHFKFP-VSRDQ 418
            .|...::.|..|.|::..|..||||:|.|.| ...:.|.:|...|...||.:::...:. ::.|.
Mouse   110 MLHCRILRAKGLKPMDFNGLADPYVKLHLLPGACKANKLKTKTQRNTLNPVWNEELTYSGITDDD 174

  Fly   419 LQGKELILQVLDYDRYSHNDIIGEVRISVDGLDLSK--------------------SVEIWGDLL 463
            :..|.|.:.|.|.|:.|||:.|||:|:.:..|..|:                    |..:.|...
Mouse   175 ITHKVLRISVCDEDKLSHNEFIGEIRVPLRRLKPSQKKHFNICLERQVPLPSPSSMSAALRGISC 239

  Fly   464 RTKKPK---------EDRPELLCSLNYLPQAERLTVVIMKARNLDTL-----QEPYVKIYLIQNG 514
            ..|:.:         |:|..:|.||:|..:...|.|.|::..:|..:     .:||||.||..:.
Mouse   240 YLKELEQAEQGPGLLEERGRILLSLSYSSRRHGLLVGIVRCAHLAAMDVNGYSDPYVKTYLRPDV 304

  Fly   515 KRIKKKKTSITKSDDPTNPIWNEAFTFNLQSNYLHNAAIEI----YVVGAGSEATEIGCCGLGPQ 575
            .:..|.||.:.|.  ..||.:||.|.:.::.:.|....:|:    |.:|..::.  ||...|||.
Mouse   305 DKKSKHKTCVKKK--TLNPEFNEEFFYEIELSTLATKTLEVTVWDYDIGKSNDF--IGGVSLGPG 365

  Fly   576 ESGTGCQHWHDMINNARKPTAMWH 599
            ..|...:||:|.::........||
Mouse   366 ARGEAQKHWNDCLHQPDTALERWH 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SytbetaNP_648734.1 C2 341..463 CDD:301316 38/143 (27%)
C2B_Synaptotagmin 473..601 CDD:175975 38/136 (28%)
Doc2aNP_001355284.1 Interaction with UNC13D and DYNLT1. /evidence=ECO:0000250 1..94 31/113 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..54 9/27 (33%)
C2A_Rabphilin_Doc2 95..218 CDD:176000 36/122 (30%)
Interaction with UNC13D. /evidence=ECO:0000250 220..405 43/174 (25%)
C2B_Rabphilin_Doc2 259..391 CDD:176030 38/135 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.