DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sytbeta and PLA2G4E

DIOPT Version :9

Sequence 1:NP_648734.1 Gene:Sytbeta / 39630 FlyBaseID:FBgn0261090 Length:602 Species:Drosophila melanogaster
Sequence 2:NP_001193599.1 Gene:PLA2G4E / 123745 HGNCID:24791 Length:868 Species:Homo sapiens


Alignment Length:327 Identity:64/327 - (19%)
Similarity:106/327 - (32%) Gaps:90/327 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 SLASLAGGSGMG--------------GSSAGKGVAGGRCLSPLLIPPRSQPGVDPAMGPASPLGA 317
            ||.:..|..|:|              ||.:|:..:.......|     ..||: |...|.:|.| 
Human     2 SLQASEGCPGLGTNVFVPQSPQTDEEGSRSGRSFSEFEDTQDL-----DTPGL-PPFCPMAPWG- 59

  Fly   318 LQPDLYRMPDGPVYLTAPESSHAVGRLHLRVKYDYHLFDLTVHLIEAHNLSPIEEGGFRDPYVRL 382
                               |...:...||          |||.:|...|:...:.....|.:|.|
Human    60 -------------------SEEGLSPCHL----------LTVRVIRMKNVRQADMLSQTDCFVSL 95

  Fly   383 MLQPEVDSRKRQTHIHRGESNPYFDQHFKFPVSRDQLQGK---ELILQVLDYDRYSHNDIIGEVR 444
            .| |....:|.:|.......||.:::.|.|     |:|.:   .|.|.|.|.|..:.:|.:..|.
Human    96 WL-PTASQKKLRTRTISNCPNPEWNESFNF-----QIQSRVKNVLELSVCDEDTVTPDDHLLTVL 154

  Fly   445 ISVDGLDLSKSVEIWGDLLRTKKP------KEDRPELLCSLNYLPQAERLTVVIMKARNLDTLQE 503
            ..:..|...|...:       |.|      :|...|.|...:..|....:|..::.:|.:..|: 
Human   155 YDLTKLCFRKKTHV-------KFPLNPQGMEELEVEFLLEESPSPPETLVTNGVLVSRQVSCLE- 211

  Fly   504 PYVKIYLIQNGKRIKKKKTSITKSDD---------------PTNPIWNEAFTFNLQSNYLHNAAI 553
              |.....:..||.|.|...:..::.               ||:..:..|..|:....:.....:
Human   212 --VHAQSRRRRKREKMKDLLVMVNESFENTQRVRPCLEPCCPTSACFQTAACFHYPKYFQSQVHV 274

  Fly   554 EI 555
            |:
Human   275 EV 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SytbetaNP_648734.1 C2 341..463 CDD:301316 29/124 (23%)
C2B_Synaptotagmin 473..601 CDD:175975 16/98 (16%)
PLA2G4ENP_001193599.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..46 9/48 (19%)
C2_cPLA2 69..177 CDD:176001 30/130 (23%)
cPLA2_Grp-IVB-IVD-IVE-IVF 320..863 CDD:132840
Required for localization at membrane structures. /evidence=ECO:0000269|PubMed:30517655 857..868
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.