DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sytbeta and LOC100497338

DIOPT Version :9

Sequence 1:NP_648734.1 Gene:Sytbeta / 39630 FlyBaseID:FBgn0261090 Length:602 Species:Drosophila melanogaster
Sequence 2:XP_002938753.2 Gene:LOC100497338 / 100497338 -ID:- Length:398 Species:Xenopus tropicalis


Alignment Length:276 Identity:86/276 - (31%)
Similarity:139/276 - (50%) Gaps:30/276 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   342 GRLHLRVKYDYHLFDLTVHLIEAHNLSPIEEGGFRDPYVRLMLQPEVDS--RKRQTHIH------ 398
            |:|.|.:.||.....|.:::|||.:| |...   .||:||:.:..:.|.  ...||.||      
 Frog   131 GKLKLSLYYDKKKMALLINVIEATDL-PAHS---HDPFVRIKVFSKADDPHSSVQTIIHEWDTKV 191

  Fly   399 -RGESNPYFDQHFKFPVSRDQLQGKELILQVLDYDRYSHNDIIGEVRISVDGLDLSKSVEIWGDL 462
             :...||.|.:.|...:...||....|..:|.|:|:||.:.:|||.|.::.||..||::|::.||
 Frog   192 VKNSRNPVFVESFTCTLKESQLLSTSLKFEVKDFDKYSRHTLIGETRATLQGLKTSKTLELYEDL 256

  Fly   463 LRTKKPKEDRPELLCSLNYLPQAERLTVVIMKAR--NLDTLQE--PYVKIYLIQNGKRIKKKKTS 523
              .:|.|:...|:|.||..||.|:::.|.|:|.:  :|.|:.|  .|.:|.:..|..:.|.:|:|
 Frog   257 --QE
KTKDAIGEVLISLKCLPTAQKIEVGILKFKTSSLSTISERDVYARIDVFTNQHKQKHQKSS 319

  Fly   524 ITKSDDPTNPIWNEAFTFNL----QSNYLHNAAIEIY-VVGAGSEATEIGCCGLGPQESGTGCQH 583
            :......|  ::||.|.|.|    :::.|  ..:.:| .:.:|.:.  ||...||.|.:.....|
 Frog   320 LRAKSKVT--VFNETFLFGLPDPGKTHCL--ILVSLYETIASGRKL--IGQTSLGNQNTKAEDGH 378

  Fly   584 WHDMINNARKPTAMWH 599
            |..|:...|:|.|.||
 Frog   379 WELMMQTLRQPVAKWH 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SytbetaNP_648734.1 C2 341..463 CDD:301316 42/129 (33%)
C2B_Synaptotagmin 473..601 CDD:175975 41/136 (30%)
LOC100497338XP_002938753.2 C2 129..258 CDD:417471 43/132 (33%)
C2 265..396 CDD:417471 41/136 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.