DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sytbeta and syt1b

DIOPT Version :9

Sequence 1:NP_648734.1 Gene:Sytbeta / 39630 FlyBaseID:FBgn0261090 Length:602 Species:Drosophila melanogaster
Sequence 2:NP_001082930.1 Gene:syt1b / 100034471 ZFINID:ZDB-GENE-060503-166 Length:388 Species:Danio rerio


Alignment Length:275 Identity:99/275 - (36%)
Similarity:155/275 - (56%) Gaps:43/275 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   336 ESSHA--VGRLHLRVKYDYHLFDLTVHLIEAHNLSPIEEGGFRDPYVRLMLQPEVDSRKRQTHIH 398
            ||..|  :|:|...:.|::....|.|.:|.|..|:.::..|..||||::.|.|: ..:|.:|.:|
Zfish   137 ESKEAQKLGKLLYTLDYNFTDSTLIVGVIRAEGLAAMDMSGTSDPYVKVYLLPD-KKKKFETKVH 200

  Fly   399 RGESNPYFDQHFKFPVSRDQLQGKELILQVLDYDRYSHNDIIGEVRISVDGLDLSKSVEIWGDLL 463
            |....|.|::||.|.|...:|.||.|::.|.|:||:|.:|.||:||:.::.:|.|...|.|.||.
Zfish   201 RKTLEPTFNEHFTFKVPYAELGGKTLVMTVYDFDRFSKHDAIGDVRLQMNKVDFSHLTEEWRDLQ 265

  Fly   464 RTKKPKEDRPELLC-SLNYLPQAERLTVVIMKARNLDT-----LQEPYVKIYLIQNGKRIKKKKT 522
            :.:|.:::|...:| ||.|:|.|.:||||:::|:||..     |.:|||||:|:|||||:|||||
Zfish   266 KAEKEEQERLGDICLSLRYVPTAGKLTVVVLEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKT 330

  Fly   523 SITKSDDPTNPIWNEAFTFNLQSNYLHNAAIEIYVVGAGSEATEIGCCGLGPQESGTGCQHWHDM 587
            :|.|  :..||.:||:|:|.:.|..:.                                :||.||
Zfish   331 TIKK--NTLNPYYNESFSFEVPSEQIQ--------------------------------RHWSDM 361

  Fly   588 INNARKPTAMWHYIR 602
            :.|.|:|.|.||.::
Zfish   362 LANPRRPIAQWHALK 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SytbetaNP_648734.1 C2 341..463 CDD:301316 44/121 (36%)
C2B_Synaptotagmin 473..601 CDD:175975 49/133 (37%)
syt1bNP_001082930.1 C2A_Synaptotagmin-1-5-6-9-10 143..266 CDD:176031 45/123 (37%)
C2 275..376 CDD:301316 49/134 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1028
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D925064at2759
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.