DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sytbeta and syt19

DIOPT Version :9

Sequence 1:NP_648734.1 Gene:Sytbeta / 39630 FlyBaseID:FBgn0261090 Length:602 Species:Drosophila melanogaster
Sequence 2:XP_001343313.4 Gene:syt19 / 100003865 ZFINID:ZDB-GENE-090602-3 Length:384 Species:Danio rerio


Alignment Length:286 Identity:77/286 - (26%)
Similarity:138/286 - (48%) Gaps:26/286 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   336 ESSHAVGRLHLRVKYDYHLFDLTVHLIEAHNLSPIEEGGFRDPY--VRLMLQPEVDSRKR----- 393
            |..|..|.|...:.||.....:.|.:::|.:|:..:.....||:  ||||.....|..|.     
Zfish   103 EEEHIQGSLRFSLFYDQLQSKMVVTVLDAQDLAVRDFSHSVDPFVWVRLMWAEREDKEKNSMRCL 167

  Fly   394 ----QTHIHRGESNPYFDQHFKFPVSRDQLQGKELILQVLDYDRYSHNDIIGEVRISVDGLDLSK 454
                ||.|.:....|.|...|...::.|::....:..:|.|:|:||.:.::||.|.|::.|.:|.
Zfish   168 LHEWQTRIVKNSCCPVFGDQFSCILAEDEVSRVTVRFEVRDFDKYSRHGVLGETRASLNTLKISY 232

  Fly   455 SVEIWGDLLRTKKPKED-RPELLCSLNYLPQAERLTVVIMKARNL----DTLQEPYVKIYLIQNG 514
            .:|:..||   :.|::| ..|.|.||.|:|.::||.|.::|...:    .|.:..|.:..:..|.
Zfish   233 PLELRQDL---QVPRKDIVGEALLSLKYMPTSQRLEVGVLKIHTVCYHNKTERALYARTIVTCNQ 294

  Fly   515 KRIKKKKTSITKSDDPTNPIWNEAFTFNLQSNYLHNAAIE--IYVVGAGSEATE--IGCCGLGPQ 575
            .|::.::|:..|..:.|  ::||..||.|....:...:||  :|.:....::::  ||...:...
Zfish   295 SRLRHQRTTQKKRREVT--VFNEVMTFVLPDQQIKECSIEVSVYEIQPSKKSSKNLIGHIQVKKN 357

  Fly   576 ESGTGCQHWHDMINNARKPTAMWHYI 601
            ::|.. :||..|:.:.|:|.|.||.|
Zfish   358 KTGEN-EHWKQMMQSLRQPVANWHLI 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SytbetaNP_648734.1 C2 341..463 CDD:301316 35/132 (27%)
C2B_Synaptotagmin 473..601 CDD:175975 36/135 (27%)
syt19XP_001343313.4 C2 109..241 CDD:301316 36/134 (27%)
C2 249..382 CDD:301316 36/135 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000025
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.