DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Reck and SPINK2

DIOPT Version :9

Sequence 1:NP_001261853.1 Gene:Reck / 39629 FlyBaseID:FBgn0036463 Length:1071 Species:Drosophila melanogaster
Sequence 2:XP_024309959.1 Gene:SPINK2 / 6691 HGNCID:11245 Length:187 Species:Homo sapiens


Alignment Length:56 Identity:15/56 - (26%)
Similarity:21/56 - (37%) Gaps:9/56 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   463 PEHDAAAREDWQLLQQRGTVRVLGQELFIKNTSRCAPDKWRALVCALQLKPCTRVG 518
            |.|:.:.|.. |:..:||.....|      ...||....||.  |:.||.....:|
Human    93 PSHERSLRVA-QVTDRRGKTAGAG------GGWRCRCCAWRC--CSWQLPSQVALG 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ReckNP_001261853.1 KAZAL_FS 729..>753 CDD:238052
SPINK2XP_024309959.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3649
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.