powered by:
Protein Alignment Reck and SPINK2
DIOPT Version :9
Sequence 1: | NP_001261853.1 |
Gene: | Reck / 39629 |
FlyBaseID: | FBgn0036463 |
Length: | 1071 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_024309959.1 |
Gene: | SPINK2 / 6691 |
HGNCID: | 11245 |
Length: | 187 |
Species: | Homo sapiens |
Alignment Length: | 56 |
Identity: | 15/56 - (26%) |
Similarity: | 21/56 - (37%) |
Gaps: | 9/56 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 463 PEHDAAAREDWQLLQQRGTVRVLGQELFIKNTSRCAPDKWRALVCALQLKPCTRVG 518
|.|:.:.|.. |:..:||.....| ...||....||. |:.||.....:|
Human 93 PSHERSLRVA-QVTDRRGKTAGAG------GGWRCRCCAWRC--CSWQLPSQVALG 139
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Reck | NP_001261853.1 |
KAZAL_FS |
729..>753 |
CDD:238052 |
|
SPINK2 | XP_024309959.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3649 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.