DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Reck and tmeff1a

DIOPT Version :9

Sequence 1:NP_001261853.1 Gene:Reck / 39629 FlyBaseID:FBgn0036463 Length:1071 Species:Drosophila melanogaster
Sequence 2:XP_698980.5 Gene:tmeff1a / 570409 ZFINID:ZDB-GENE-070912-294 Length:336 Species:Danio rerio


Alignment Length:292 Identity:74/292 - (25%)
Similarity:102/292 - (34%) Gaps:108/292 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   679 LPGARSYRHGSSFYLECNLCSCFAGEITCTKQQCRLPGFVDSGYTSLPC----NCPAHYVPVCGS 739
            |.|.:|..|      .||..||..|.|      ||     |:| :.|.|    .||..:.|||||
Zfish    49 LSGNKSGLH------VCNESSCVFGGI------CR-----DNG-SHLECLCQFQCPRMFDPVCGS 95

  Fly   740 NGNTYPSACVAKCHLPEGDYVYGACNARNACQAAPPNSCP-----SGTQCLDSRKVCLASMQRPC 799
            :|:||.|.|..:         ..||..::.........||     ||...|:|      |...| 
Zfish    96 DGDTYHSECFLR---------QAACEQQSPITIITEGHCPDAESASGDTDLES------SGLEP- 144

  Fly   800 LQYVCVNATASNCSTFHQGEVC--DSQGRTYPNACALLKANPQGQVAYWSACQSSRFNTSPSPVC 862
                   ::.|.||:...|..|  ||:|                   .|..|.......:.:|||
Zfish   145 -------SSYSRCSSCRFGAECDEDSEG-------------------IWCVCNIDCGGYNLNPVC 183

  Fly   863 GINGVTYKSSYAARAEYVL------VDYVGRCREVGLLV--SDMGR---------------RCR- 903
            |.:|.:|.:....|....|      |.::|:|....:||  :::||               .|. 
Zfish   184 GSDGQSYSNPCQVREASCLKQAQINVRHLGQCSGSAVLVGGANVGRAMPCPEINSSSCVHGTCEM 248

  Fly   904 -----TVKCPAPVS-KHCRL-------IVPPG 922
                 |.:|....| |||.|       :||.|
Zfish   249 KNDLATCRCNLGFSGKHCELRDFSELYVVPNG 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ReckNP_001261853.1 KAZAL_FS 729..>753 CDD:238052 12/23 (52%)
tmeff1aXP_698980.5 KAZAL 81..125 CDD:197624 14/52 (27%)
KAZAL 169..215 CDD:197624 11/45 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3649
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.